KEGG   Drosophila willistoni: Dwil_GK13955Help
Entry
Dwil_GK13955      CDS       T01067                                 

Definition
GK13955 gene product from transcript GK13955-RA
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     Dwil_GK13955
Peptidases [BR:dwi01002]
 Serine Peptidases
  Family S8: subtilisin family
   Dwil_GK13955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 669 aa AA seqDB search
MFIAAAARSCTAASWRFLVAGLMVLSLLSLNNFNVEAGAGGSTGSGGLGNQAVFTSSFLV
RFRRSVDNDFAHKVADKYGFDNLGPLVGADGQEYHFKHRTLPHARSRRSLSHTRALKSHP
AVNTAVQQPGFRRVKRGLRPALPSIHGMQFEGIASEPTNQINTEPTDPYFPMQWYLKNTG
QNGGKVRLDLNVQAAWAQGITGKNVTTAIMDDGVDYMHPDLRFNYNAEASYDFSSNDPFP
YPRYTDDWFNSHGTRCAGEVSAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMG
HEPHKIHIYSASWGPTDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDD
CNCDGYAASMWTISINSAINDGQNAHYDESCSSTLASTFSNGAKDPNTGVATTDLYGKCT
TTHSGTSAAAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVG
LEFNHLFGFGVLDAGAMVTLSKQWHAVPPRYHCEAGEITDAQPIVMGRSLFWEIKTDACK
GTDTEVNYLEHVQAVISANASRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFM
TTHSWGEYPQGTWKLEARFNSPQTRHGHLLEWSLVLHGTKEAPYRTLHPSSPHSKLAIVK
KAHEDKKMK
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgcagcagctgcaaggagctgcactgctgcttcatggcgttttctggtcgcc
gggcttatggtcctttcgctgttgagtctaaacaactttaatgtggaagcaggtgccggc
ggttcaaccggatctggcggactgggaaatcaggcggtattcaccagctcgtttctagtg
cgtttccgtcgaagtgttgacaatgacttcgctcacaaggtggccgacaaatatggcttc
gacaacttgggaccgctggtgggcgccgatggacaagagtatcatttcaagcatcggact
ctcccacatgcccgctcccggcgtagtctgtcgcacacgcgtgccctcaagagtcatccg
gcggttaacacagcagtgcaacaaccgggatttcggcgcgtgaagcgtggtcttcgacct
gccctcccttccatacatggcatgcagttcgaaggcattgccagtgagcccaccaatcag
ataaatacagagccaacagatccttattttcccatgcaatggtatctcaagaatactgga
caaaatggtggcaaagtgcgtttggatctgaatgtgcaggctgcttgggcgcagggcatt
acgggcaagaatgtgacaacagccattatggatgatggagtggactacatgcatccggat
ttacgatttaattataatgccgaggccagctatgactttagcagtaatgatccttttcca
tatcctcgatacacggatgattggtttaatagtcatggaactcgctgtgctggcgaagta
tctgctgccagagataatggaatttgtggcgttggcgttgcttatgacagcaaaatcgca
ggcatacgcatgctggatcagccttatatgacggacctaatcgaagccaactccatgggc
catgaaccacacaagattcacatatacagtgcttcgtggggtcccactgatgatggcaag
acggtggatggtcctcgaaatgccaccatgcgcgccattgtccagggtgtcaatgagggt
cgcaacggtctgggtaacatctatgtttgggcatcgggcgatggtggtgaggaggacgat
tgcaactgcgatggctatgccgcctccatgtggaccatttccattaatagcgctattaac
gacggtcagaacgcacactacgatgaaagctgcagctccacgctggcatcgacatttagc
aatggtgccaaggatcccaatacgggcgttgccaccaccgacctgtacggcaaatgcacg
accacgcactctggcaccagcgctgcggcgcccgaagcagcaggcgtctttgctctggcc
ctggaggcaaatccgcaattgacttggcgcgacatccaacatctcacagtgttgacgtcg
aaacgtaattcgttgtttgatgccaagaaccgtttccactggacaatgaacggcgttggc
ctggagttcaatcacctctttggcttcggtgttctagatgcgggtgccatggtgacgttg
tctaagcaatggcatgcagtcccaccacgctatcactgtgaggcaggcgaaataaccgat
gcccagccaattgtcatgggtcgttcgttgttttgggaaatcaaaaccgatgcctgcaag
ggaaccgatacagaagtgaactacttggagcatgtacaggctgtcatctcggcgaatgct
tccagacgaggtgacctcgagctcttccttacttcacccatgggtactaagtctatgatt
ctgtcccgacgtgccaatgatgatgatcatcgggatggctttaccaaatggccatttatg
actacccactcttggggcgagtatccccagggtacttggaaactagaggctcgtttcaat
tctccccaaacgcgtcatggacacttgttggaatggtctcttgttttgcatggcacaaag
gaggcaccctatcgcacacttcatccctcatcgccacactcaaagctggccattgtgaag
aaggcccacgaggataagaagatgaagtag

DBGET integrated database retrieval system