KEGG   Drosophila willistoni: Dwil_GK13980Help
Entry
Dwil_GK13980      CDS       T01067                                 

Definition
GK13980 gene product from transcript GK13980-RA
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
dwi  Drosophila willistoni
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dwil_GK13980
Enzymes [BR:dwi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Dwil_GK13980
Glycosyltransferases [BR:dwi01003]
 Polysaccharide
  Storage polysaccharide
   Dwil_GK13980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 709 aa AA seqDB search
MRRQMSYRFEDQDASPYALKMNRRFSRVESGADLKDYFDRGDIASRENRWNFEVAWEVAN
KVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKENCARTEMEEMEFPRGNPLLDAVNSLRSR
GYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFM
IAEFLEEFRNFAVSYSQNNGLSAPRIVAHFHEWQAGVGLIVLRTRQVEIATVFTTHATLL
GRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCLERGATHLAHIFTTVSEITGYEAEHL
LKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHMDFDLDKTLYFFIA
GRYEFGNKGADIFIESLARLNAMLKHERPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQL
RDTINNVQQAVGKRMFDTCLKGHIPNADDLLEKDDLVKIKRCMFAMQRDSMPPVTTHNVA
DDWNDPVLSSIRRCHLFNSVHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYY
EPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHISDPKSYGIYIVDRRYIGLENSVQQLSS
FMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYIDETTLYGS
RNNLIFSRPHSEPPSPTSSRHTTPAPSVHGSDDEDSVDEETELKELGIK
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtcaaatgtcctatcgctttgaagatcaagatgcctcgccgtatgccttaaaa
atgaatcgtcgtttttcgcgtgtagaatccggtgcggatttaaaggattatttcgatcgc
ggtgatatagcatcacgtgagaatcgctggaatttcgaagtagcatgggaggtggccaac
aaggtcggtggcatttatacagtcattcggtcgaaggcctatgtctccaccgaagaaatg
ggcgagcagctgtgcatgatgggaccttacaaggagaattgtgcccgcactgagatggag
gaaatggaatttccgcgtggcaatcctttgcttgatgctgtgaatagcctgcgttctcgt
ggctataaaatccatacaggacgttggctagtcgatggcaatccgcaattgatactcttc
gacattggctcggccgcatggaaattagatcaattcaaatcggaaatgtgggaaaaatgc
cacattggtataccacatttggatattgagacaaatgatgccattatcttgggtttcatg
attgctgaattcctggaagagttccgtaatttcgcagtatcatattctcagaacaatggc
ctcagtgctccgcgaattgtggcccatttccatgagtggcaagccggtgtcggtttgata
gtcctaaggacacgtcaagtcgagattgcaactgtttttaccacccatgctaccctgttg
ggtcgttatctgtgtgctggcaacacggatttctataataatctcgacaaattcgctgtc
gatgaggaggcgggcaaacgacagatctatcatcgctattgcctggagcgtggtgcaaca
catttggcccatatattcacgaccgtatcggaaatcacgggctacgaggcggagcatttg
ctcaagaggaaaccagatatcattacgccaaacggtttgaatgtcaagaaattctcagct
atacacgagttccagaatttgcatgccgtggccaaggagaagatcaacgagtttgtacgt
ggacatttctatggccacatggatttcgatttggataagaccttgtacttcttcattgcc
ggccgctatgagtttggcaacaagggtgccgatattttcattgaatcgcttgccagattg
aatgccatgttaaaacatgaacgtcccgataccacagtggtggccttcctcatttttcca
acgaaaaccaataatttcaatgtggattcgttgcgtggccatgctgtgattaagcagcta
cgtgataccatcaataatgttcagcaggctgtgggtaaacgtatgtttgatacttgcctc
aagggtcacatccccaatgccgatgatctgctggagaaggatgatctggtgaagatcaaa
cgttgtatgtttgccatgcaacgtgactccatgccgccggtgactacgcataatgtggcc
gacgattggaatgatcccgtcttgtcatcgattcgtcgctgtcatctgttcaactcagtg
catgatcgcgttaaaatggtcttccatccggagtttttgacctcgacaaatccattgttt
ggcatcgactacgaggaatttgtgcgtggctgtcatttgggtgttttcccctcttactac
gagccctggggatatacaccagccgaatgtacggtgatgggcataccaagtgtgaccaca
aatctgtccggattcggttgtttcatgcaggagcatatcagtgatcccaaatcctatggc
atctatattgtcgatcgtcgttacattggcctcgagaacagtgtccaacaattgtctagc
ttcatgatggaattctcacgtctaaatcgccgtcagcgtatcattcaacgtaatcgcaca
gagcgtctcagcgatttgctcgactggcgtactctgggcatttactacagacaggcaagg
gttaaggcattgcaagccgtctatccggactatatagatgaaacgactttgtacggttca
cggaataatttgattttctcgcgtccccacagtgaaccgcctagccctacctcatcgcgt
cacaccacaccagctccatcggttcatggttccgatgatgaggactctgtggatgaagaa
accgagctcaaggaattaggcatcaaataa

DBGET integrated database retrieval system