KEGG   Drosophila willistoni: Dwil_GK14398Help
Entry
Dwil_GK14398      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
Organism
dwi  Drosophila willistoni
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase Abhydrolase_6 zf-C4H2
Motif
Other DBs
NCBI-GeneID: 6650223
NCBI-ProteinID: XP_002073988
FlyBase: FBgn0216404
UniProt: B4NJE3
Position
Unknown
AA seq 436 aa AA seqDB search
MAIISVLIYVCLWLAAAKLEANSKEHETGATKVENNFADYSAQNEALAQKVDAENNQLQE
LQLLNDVDDDEQLLRLQNYNLLYNAERQTYFQLHTSNHPHSNPPPSGSEHQNQLNPSAVQ
HHRLLQHVVGNTLTAAFGLNLMDNASKDIMLMTTENIKLYDSNSLRHSRFNPFNPTRIII
HGWLGNAHANIYNTLLPAYMNLSTGNYNVFTVDWGRGAIADYITASYRVKPVGQVVAKFV
DFLHQEAGMRFEDLQLIGFSMGAHVAGLAGKYVQTGRLKVIRALDPALPFFRYAQEKERL
TMDDADYVEVLHTSVGSYGFDRPLGHVDFYANWGSQQPGCFWHECSHWRAFILFGESLQL
PLFEQIEGKGCVTSEWQQLTKSRHCAQETDNMLSMAGDLMELSMDQLARRRGVYYFQTND
MPPYMARIVNKKERGT
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggccatcattagtgtcctcatttacgtttgtttgtggcttgctgcagcaaaattggag
gcaaattcaaaagagcacgaaacgggggcgacaaaagtggagaacaactttgctgattat
agtgctcagaatgaggctttggcccagaaggtcgatgcagaaaacaatcaattgcaggag
ctacaactgctgaatgatgttgatgacgatgagcaattactacgactgcagaactacaat
ttgctgtacaatgccgaacgtcagacctacttccagttgcacaccagcaatcatccgcat
agtaatccgcctccgtctgggtccgagcatcaaaatcaactcaatccctccgccgtgcag
catcatcgtctattacagcatgttgtgggcaatacattgacagctgcctttggccttaat
ctgatggataatgccagtaaggatattatgctaatgaccacagagaatatcaaactttat
gattccaactccttgcggcactcgcgatttaatccgttcaatccaacacgcattattatc
catggttggctgggtaatgcccatgccaatatatacaatactttgcttccggcctatatg
aatctaagtactggaaattataatgtattcactgtggattggggacgtggagccattgca
gattatataacagcaagttatcgagttaagcctgttggccaagttgtggccaaattcgtg
gactttctgcatcaggaggccggcatgagattcgaagatctacaattgattggcttcagt
atgggtgcccatgtggctggattggctggcaaatatgtccaaactggacgtttgaaggtg
atacgagctcttgatccggcattgcctttctttcgctatgcccaagagaaagagcgcctg
acaatggacgatgccgactatgtagaagtattgcatacaagtgtgggcagctatggcttc
gatcgtcctttgggacatgtggatttctatgcgaattggggcagccagcagccaggatgc
ttttggcatgaatgcagccattggcgtgcatttatactattcggcgagagtctgcaattg
ccgttgttcgagcagattgagggcaaaggttgtgtgaccagcgaatggcagcaattgacc
aaatcccggcactgtgcacaggaaacggataacatgctcagcatggctggtgatttaatg
gaactgtcaatggaccagctagccagacgaaggggagtctattattttcaaactaatgac
atgccgccatatatggccagaatagttaacaaaaaagaaagaggaacttaa

DBGET integrated database retrieval system