KEGG   Drosophila willistoni: Dwil_GK14398Help
Entry
Dwil_GK14398      CDS       T01067                                 

Definition
(RefSeq) GK14398 gene product from transcript GK14398-RA (EC:3.1.1.- 3.1.1.1)
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dwi  Drosophila willistoni
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dwil_GK14398
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dwil_GK14398
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dwil_GK14398
  Exosomal proteins of breast milk
   Dwil_GK14398
Glycosaminoglycan binding proteins [BR:dwi00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   Dwil_GK14398
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dwi00537]
 Enzymes
  Dwil_GK14398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 436 aa AA seqDB search
MAIISVLIYVCLWLAAAKLEANSKEHETGATKVENNFADYSAQNEALAQKVDAENNQLQE
LQLLNDVDDDEQLLRLQNYNLLYNAERQTYFQLHTSNHPHSNPPPSGSEHQNQLNPSAVQ
HHRLLQHVVGNTLTAAFGLNLMDNASKDIMLMTTENIKLYDSNSLRHSRFNPFNPTRIII
HGWLGNAHANIYNTLLPAYMNLSTGNYNVFTVDWGRGAIADYITASYRVKPVGQVVAKFV
DFLHQEAGMRFEDLQLIGFSMGAHVAGLAGKYVQTGRLKVIRALDPALPFFRYAQEKERL
TMDDADYVEVLHTSVGSYGFDRPLGHVDFYANWGSQQPGCFWHECSHWRAFILFGESLQL
PLFEQIEGKGCVTSEWQQLTKSRHCAQETDNMLSMAGDLMELSMDQLARRRGVYYFQTND
MPPYMARIVNKKERGT
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggccatcattagtgtcctcatttacgtttgtttgtggcttgctgcagcaaaattggag
gcaaattcaaaagagcacgaaacgggggcgacaaaagtggagaacaactttgctgattat
agtgctcagaatgaggctttggcccagaaggtcgatgcagaaaacaatcaattgcaggag
ctacaactgctgaatgatgttgatgacgatgagcaattactacgactgcagaactacaat
ttgctgtacaatgccgaacgtcagacctacttccagttgcacaccagcaatcatccgcat
agtaatccgcctccgtctgggtccgagcatcaaaatcaactcaatccctccgccgtgcag
catcatcgtctattacagcatgttgtgggcaatacattgacagctgcctttggccttaat
ctgatggataatgccagtaaggatattatgctaatgaccacagagaatatcaaactttat
gattccaactccttgcggcactcgcgatttaatccgttcaatccaacacgcattattatc
catggttggctgggtaatgcccatgccaatatatacaatactttgcttccggcctatatg
aatctaagtactggaaattataatgtattcactgtggattggggacgtggagccattgca
gattatataacagcaagttatcgagttaagcctgttggccaagttgtggccaaattcgtg
gactttctgcatcaggaggccggcatgagattcgaagatctacaattgattggcttcagt
atgggtgcccatgtggctggattggctggcaaatatgtccaaactggacgtttgaaggtg
atacgagctcttgatccggcattgcctttctttcgctatgcccaagagaaagagcgcctg
acaatggacgatgccgactatgtagaagtattgcatacaagtgtgggcagctatggcttc
gatcgtcctttgggacatgtggatttctatgcgaattggggcagccagcagccaggatgc
ttttggcatgaatgcagccattggcgtgcatttatactattcggcgagagtctgcaattg
ccgttgttcgagcagattgagggcaaaggttgtgtgaccagcgaatggcagcaattgacc
aaatcccggcactgtgcacaggaaacggataacatgctcagcatggctggtgatttaatg
gaactgtcaatggaccagctagccagacgaaggggagtctattattttcaaactaatgac
atgccgccatatatggccagaatagttaacaaaaaagaaagaggaacttaa

DBGET integrated database retrieval system