KEGG   Drosophila willistoni: Dwil_GK14418Help
Entry
Dwil_GK14418      CDS       T01067                                 

Definition
(RefSeq) GK14418 gene product from transcript GK14418-RB
  KO
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
dwi  Drosophila willistoni
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dwil_GK14418
Enzymes [BR:dwi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dwil_GK14418
Chromosome [BR:dwi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dwil_GK14418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1062 aa AA seqDB search
MVCPDPLGQLVSKAPALPQRPTTENASLRIQVHVRFFADNGRRNWIKPENLLPFAGLKAF
EELREEVRIKQGAKSGKYRQMVPKRNKMAVWQQAIEEAQMIAELPYAERLEKFCQMYENA
IALNRQKRSSSMLQDTSDMGSSLYDSTDNLHARAPPLQPLIALKRERSESPLSPAFSPVK
HLNEKRSKRRKLSSEAETETGPASSAVSSTNKTITTTSSGIYGNSEFGQLYNAIKEYVMG
YQQDEKVEKVLLSVVNNIWSLKQIQLRELERVVANDEIRQQQHQQQLGSTLPNNARSGSG
DNSSATTKRLSSRLKSMMLQRSITPVVVPDTVEPVAETRASETPKPRKPVNRPIEEVVED
ILHLDRKYLFRGLNKEPVCKYCHEPGSELQRCSRGCNTWLHASCLERELNGVANATYKTG
RGRKPTVTATPLEPITSSTPNSEAETGHVESEREPVELVCQECITGQSDACCICHKLQPP
SISPPASPLKETGEQSQSQSLVVCSQPMCSTKFHISCCKYWPQANASKSSARCPMHVCHT
CVSDDPSNRYQQLGSSKLCKCVKCPATYHQDSHCIPAGSRLLTSTHLICPRHNIAKADAH
VNVLWCYICVKGGELVCCETCPIAVHAHCRNIPIKTNESYICEECESGRLPLYGEIVWAK
FNNFRWWPSIILPPTEIPSNIQKKSHGPNDFVVRFFGTHDHGWISRRRVYLYIEGDTAES
YKSKSQLVKNYATGVEEASRFLKIIKARRQEQNIGRLSSNKLMPPPYVKIKANKPVTPVR
LVSNLEDLSVCDCQPGLEHPCGPESGCLNRMLFNECNPEYCRAGDRCENQMFEMRKSPRL
DVVYMNDRGFGLVCREAIAEGDFVIEYVGEVINHAEFQKRMLQKQRDRDENYYFLGVEKD
FIIDAGPKGNLARFMNHSCEPNCETQKWSVNCIHRVGLFAIKDIPANTELTFNYLWDDLM
NNGKKACYCGAERCSGQIGGKLKDQGLKETTSAQLNGKSKGNGKVKPIQHRKSISSALRI
HIVDSGASKKSKKIKTLTATASPSNVTSKIKQISSVDSPVEQ
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgtccagatccacttggtcagcttgttagcaaagcaccggcgttaccgcagcgt
cccacaaccgaaaacgcatcgttgcgtattcaggtacatgttcgtttcttcgcagacaat
ggacgccgcaattggatcaaaccggagaaccttttgccatttgcaggtctaaaggcattc
gaagaattgcgcgaggaggttcgaatcaagcagggagcgaaaagcggaaagtaccgacag
atggtgcccaagcgtaacaaaatggcagtgtggcaacaagccatcgaggaggcacaaatg
attgccgagctgccctatgccgagcggttggaaaaattctgccagatgtacgaaaacgcc
atcgcattgaatagacaaaagcgttccagttctatgctacaggatacttccgatatgggt
agcagtctgtacgactcaacggacaatttgcatgccagggctccgcctcttcagcctctg
atagccctaaagcgtgagcgttccgaatcgccacttagccccgccttttcgccggtcaag
catttgaatgagaagcgttccaagcgacgaaaactgagtagtgaagctgaaactgagaca
ggaccggcctccagcgccgtctctagcacaaataagacaatcactaccaccagttcaggc
atttacggcaactcggaattcggacaattgtacaatgccattaaggagtatgtgatgggt
tatcagcaggatgagaaagtggagaaggtattgttatctgtagtgaataatatttggtcc
ttgaaacagattcaactacgtgaattggaacgagtggtggccaatgacgagataagacag
caacagcaccaacagcagcttggttcaactcttcctaacaatgcccgaagtggttccggc
gataattcatctgccactaccaagagattgtctagccgactgaaaagcatgatgctacaa
agaagcattacaccagttgttgttccggacacggttgaacccgtggctgagacccgtgcc
tcagagactccaaagccaaggaagccagtcaatcgacctattgaggaggttgtggaggat
attcttcacttggatcggaaatatctctttcgtggtcttaataaggagccagtttgcaaa
tattgccatgaacctggctctgaacttcagcgttgctcccgaggctgtaacacttggcta
catgccagttgtctggaacgtgaattaaacggagtggctaatgccacatataaaacgggt
agaggaagaaagcccacagtaactgctacccctctcgaaccgataacatcctcgacaccc
aattcggaagcagaaactggtcatgttgaaagtgaacgagagcccgtggaactggtgtgc
caagagtgcatcacgggtcaatcggatgcttgttgtatttgtcataaattgcagcctccc
agcatatcaccacctgcttctccccttaaggaaacgggtgagcaatcccaatctcagtcg
ctggttgtctgtagccagccaatgtgttcaacaaaattccacattagttgttgcaaatac
tggcctcaagcgaatgctagcaaatcatcagcgcggtgtccaatgcacgtgtgtcacacg
tgcgtgtcggatgatcccagcaatcgctatcagcaactgggcagctccaagctctgcaaa
tgtgtcaagtgtccagccacttatcaccaggattcacattgcattcctgcgggctcgcgc
ctgctaaccagcacccatctcatctgcccgaggcataatatcgccaaagccgatgctcat
gtgaatgttctttggtgctacatttgcgttaagggcggcgagttggtctgctgcgaaaca
tgtcccattgctgtccatgcccactgtcgtaatatacccataaagaccaacgagagttac
atctgcgaggagtgcgaaagcggacgactacccctctacggtgagattgtgtgggccaaa
tttaacaatttccgatggtggccatcgattattctgccgccaacggagattcccagcaat
attcagaagaaatctcatggacccaatgattttgtagtacggtttttcggtactcatgac
catggatggatatcgcgtcgtcgcgtttatctctatatcgagggggacactgccgaatca
tacaaaagcaagtcacagttggtcaaaaactatgctacaggagtggaagaggcatcgcgc
tttctcaagatcatcaaagcccggcggcaggagcaaaatattggacgtctaagtagcaat
aagctaatgccgccaccctatgttaaaattaaagcaaataaaccggtgacgcctgttcgg
ttggttagcaatctggaggatctaagtgtctgcgattgtcagccgggactagaacatcca
tgtggaccagaatcgggctgtctaaatcgtatgctattcaacgaatgcaatccggaatac
tgtagagccggtgatcgatgcgaaaaccaaatgtttgagatgcgcaaatctccgcgtctg
gatgttgtctacatgaatgatcggggctttggcctggtttgccgtgaagccattgccgag
ggcgactttgtcatcgagtatgtgggagaggtgatcaatcatgccgagttccagaagcgc
atgctccagaagcaacgggatcgtgacgagaattattactttttgggagtagagaaggat
ttcatcattgatgctggtcccaagggtaatctggcccggttcatgaatcattcctgcgaa
ccaaattgcgagactcaaaagtggagtgtaaattgtatacatcgtgtgggtttgtttgcc
atcaaggacattccagcgaatacggaactgacattcaattatctgtgggatgatcttatg
aacaatggcaaaaaggcatgctattgtggtgcagaacgttgttcaggtcaaattggtggc
aaactgaaagatcagggcttgaaggaaacgacgagtgcacagctaaatggaaagagcaag
ggcaatggcaaagtgaagcccattcagcatcgaaagagcatctccagtgccctgcgcatt
cacattgtagacagtggggccagcaaaaagagcaagaagatcaagactctgactgcgact
gcttcgccttcaaatgtcacttcaaaaatcaagcaaatcagttccgtcgattcacccgtg
gaacagtaa

DBGET integrated database retrieval system