KEGG   Drosophila willistoni: Dwil_GK14428Help
Entry
Dwil_GK14428      CDS       T01067                                 

Definition
GK14428 gene product from transcript GK14428-RA
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
dwi  Drosophila willistoni
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dwil_GK14428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1352 aa AA seqDB search
MDLFSKIIKRPLSLAAITTNDDGNSSSTAAGTDVSAATAANLVTTGHPLHLGDRSPLLSL
RDLLDSAAQDINQLEDQHNNLIAMPQQSAASSPSPPSTSSDSIQKLLSAIHVNLNQVSAH
EMEHLQAMSAELSPLAAIKASPKPTMEQPQQKIAALDPLKLGDPSSMIVVPPSPRGVAGG
GLPEFDESQIPELPPFSADMMMAVSGASAVTSLNSTAHDYNSDSDVFVECLSLTSDKRYS
NDPAELEAYTSAINEVLLDEQQNAMQQIDTPSGGNANPADCSYEPMDVDELNATMEILKD
VMAPEDHQLLKEQFMSDVIEKAQLLLSNDPLGETDQTPEDPLKLLNEDHYNDELEASPLT
SSDLLDNDKTQTQEVETNETFGGQEELTAHELESSALKEKHQADESQLAAHELESSALKE
MHQADEQQLNITSDPLGEVPQAPEKQTSQKEEDNIDDIKTKVLDLPENDVDTQNIEIEKI
YVQPVENIPLSPPIPTHRAKTAEELNFLALKELPEDEGSQEKIQKADNEPKVIPIAFVTP
TCMTTMPIGPQTTNNPTFPTSPRSPTFPVQDPAEPPSHFPHSPHAPAETEEMPYLEQAVV
QPSSDRPLSGVIAKMPVSINIIQSSPEEKENKLDINETLPMDEVTSPLPVFNGNSTFSSG
NENEVSASPTVKTAVAAAPLQPTATFSVSLDDVKNESRRTFTANTSPSMDTAVAAAPLQP
TDTFSVPLDDVKNESRRTFTANTGPSMETAVTAAPLQPTDTFSVSLNDDKSESRRTYNVN
NFQEEKQQQLPRRTFFVEDNRQIEENPPVLEQPSVSEKNTRKTFNLESKALEQKSPISTP
HEATEEDDFEPMDVDVSMRSAETPALTRTPSVPICNVQSAPESPPFVSTSPPIPTHQTQQ
LKRVPIHGNTTIVLDEQQLSAKEQATLSASDEKDDVFVEHFGAISPLSDDMFKTPQYTSN
NFAKIQFKEPAPTRTTNRDSRGNIAYAERAVTGERPISDAEFQDGASCNNRNNNAPVDRS
SLLLKFDPLLGTPVPVNSLQQQELALSNLLGGNNNNNNNNNRALSPTLEEHESSGSNQSF
AIETSAKSIVKELEFKPPVDRTKKHAKMSVDVIDNDCNKTFDNSNLNTEDKANNYHNMEE
LDKKLKNDVTRSEDIEKKLKDAEQREEALIKRITEKDKMNSKLNGVIEAYEKAIAELISE
KEQLVQDYDRQLQEVQTDRDANYHHLTSLETTFSDLHVKYEKSKEMTLHLRQVEETLLAE
KKQTAENLQLQEQRYEKMKSHAMQQLEIANKKLDSCNRERADEVKKLKALLKKEEVSRVS
TAEQLQQKSRENADLLKICEELIYGKGQGGSS
NT seq 4059 nt NT seq  +upstreamnt  +downstreamnt
atggatttattttcgaaaattatcaaacgaccccttagcctggcagcaatcacaacgaat
gacgatggcaacagttcatccacagcagcaggaacagacgtatcagcagcaactgcggca
aatctagtcaccaccggccatccacttcatctaggcgataggtctcctctcttatctcta
cgtgatctactcgattcggctgcccaggatatcaatcaattggaggatcagcataataat
ttaattgcaatgccacaacaatctgctgcctcctcaccatctccaccgtccacgtctagc
gatagtatacaaaaattgctaagcgccattcacgtgaatctaaatcaagttagtgcccat
gaaatggagcatttgcaggccatgagtgcggagttgagtccactggctgcaataaaggca
agtcccaagcctacaatggaacagccacagcaaaagatcgcggcattggatcctcttaag
ctgggtgatccatcatcaatgatagttgttcctccatctccaaggggcgtcgctggtggt
ggtctaccagaatttgatgaaagtcaaattcctgaattgccacctttcagtgcagacatg
atgatggcggtctctggagcttctgctgtgacttctttaaactcgactgctcatgattac
aattcggattcggatgtctttgtggaatgtttgtctttaactagcgataaacgttattca
aacgatcctgccgaactggaagcctatacaagtgcaatcaacgaagtgttgctagacgag
cagcaaaatgccatgcagcagattgatactccaagtggtgggaatgcgaaccctgccgat
tgtagctacgaaccgatggatgtcgatgaactaaatgcaacaatggaaattttaaaagat
gtcatggcaccggaggatcatcagctgttaaaggagcagtttatgagtgatgttatcgag
aaggctcagttacttttaagtaacgatcctcttggagaaacagatcagactcccgaagat
cctcttaaattgttgaatgaagatcattacaatgatgaattagaggcaagtcctttaaca
tcttcagatttgctggataacgataaaacgcaaacgcaagaagtagaaaccaatgaaact
tttggaggacaagaagaattaactgcacatgagttggaatcatcagctcttaaggagaag
catcaggctgatgaatcacaattagctgcacatgagttggagtcatctgctcttaaggag
atgcatcaggcagatgaacaacaattaaatataaccagtgatccacttggagaagtacct
caagcccccgaaaaacagacttcgcaaaaggaagaagacaacattgatgacataaagacg
aaggtcttagatttgcccgaaaacgatgtggacacgcagaacattgaaattgaaaagatt
tatgtgcagcctgtggaaaatattcctctttcacctcccatacccacacatcgggctaaa
actgcagaagaattaaacttcttggctctcaaagagttgcccgaggatgagggatcccaa
gaaaaaatacaaaaggccgataatgaaccaaaagtaataccaattgcctttgttacaccc
acatgtatgactactatgccaattggtcctcagacgaccaacaatcctacctttccgaca
tcacccagatcaccaactttcccagtgcaggatcccgccgaaccaccatcccacttccct
cattctccacatgcacctgcagagacagaggaaatgccctatctagagcaggctgtagtc
cagccatcgagtgaccgtccgttgagtggagtcatagcaaagatgcctgtgtcgattaac
attatacagtcaagccccgaggaaaaggaaaacaagcttgacataaatgaaactttacca
atggatgaggtgacatcacctttgccggtcttcaatggcaactcaactttcagtagtgga
aacgagaatgaagtgagtgccagtccaacagtaaagacagctgtcgctgctgccccactc
caaccaacagctacattttctgtgtccttggatgatgtcaagaatgaatcgcgaagaaca
tttactgcaaatactagcccatctatggatacggctgtggctgctgctccactccagcca
acagatacattttctgtgcccttagatgatgtcaagaatgagtcgcggagaacatttact
gcaaatactggcccatctatggagacggctgtaactgctgctccactccagccaacagat
acatttagtgtatccttgaatgacgacaagagtgagtcgcggagaacatacaatgttaat
aattttcaagaggagaagcagcagcagctgccacgtcgcactttttttgtagaagacaat
cggcagatagaagagaatcctcccgtcttggagcagccgtctgtaagtgagaaaaataca
cgaaaaactttcaacttggagtccaaagcgctagaacaaaaatcacccatttctacaccg
catgaagctaccgaggaagatgattttgaacccatggatgtcgatgtgtccatgcgatca
gccgagacaccagcgctgaccaggacgccatctgttcccatttgcaatgttcaatcggcg
ccggaatctccaccatttgtatcgacatcgcctcccattcccacccaccaaacgcagcag
ctaaagcgtgttcccattcatggcaataccaccatagttttagacgaacaacaactttcg
gccaaagaacaagcaacattgagtgccagtgacgagaaggacgatgtctttgtggagcac
tttggtgccatatcgccgttatcagatgacatgttcaaaacaccgcaatatactagcaac
aattttgccaagatccagtttaaagagcccgcacctacaaggacaaccaacagggatagt
agaggcaacattgcatatgcagagagagcagtaacaggagagagaccgatctctgatgct
gaatttcaagatggtgccagctgtaataatcgcaataataatgcgccagtcgatcgtagt
tcattattattgaaattcgatccgctgcttggcaccccagtgcccgtcaatagtctccag
cagcaggagctagccttgtcaaatctacttggcggcaataataacaacaacaacaacaat
aatcgtgccctaagtcccacattggaggagcacgagtcgagtggaagtaatcaatcgttt
gctatagaaacgagtgccaaatcgatagtaaaggaattggaatttaagcctcctgtggat
agaacaaaaaagcatgcaaaaatgagtgtggacgttattgataacgattgtaacaaaacc
ttcgataattccaatctcaatacggaggataaggcaaacaactatcacaacatggaggaa
ttggataagaaattgaaaaatgatgtaacccgctcagaggatattgaaaagaaactcaaa
gatgccgaacaacgtgaagaagccctaatcaaacgaataacagaaaaggataaaatgaat
tcaaagctaaacggcgttatcgaagcgtatgagaaagccattgctgaactaataagtgaa
aaggaacagctagtacaggattatgacaggcaattacaagaagttcaaacagatcgcgat
gcaaattaccatcacttaacgtcgctggaaacgacattctcggatctccatgttaaatat
gaaaaaagcaaagagatgacattacatcttagacaggttgaggagacgctgttggcagaa
aagaagcagacagcggagaatctgcaattgcaagaacagcgctatgagaaaatgaaaagc
catgccatgcagcagctggaaatagcaaacaaaaagctagatagctgcaatagagagcgt
gcagatgaagtgaaaaaactgaaagctttacttaaaaaagaggaagtttcacgtgtctca
acggccgagcaattgcaacagaaatctcgtgaaaatgctgatctgcttaagatatgcgag
gagcttatctatggcaagggacaaggtggtagtagttaa

DBGET integrated database retrieval system