KEGG   Drosophila willistoni: Dwil_GK14428Help
Entry
Dwil_GK14428      CDS       T01067                                 

Definition
(RefSeq) GK14428 gene product from transcript GK14428-RB
  KO
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
dwi  Drosophila willistoni
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dwil_GK14428
Messenger RNA biogenesis [BR:dwi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dwil_GK14428
   mRNA cycle factors
    P-body specific factors
     Dwil_GK14428
Chromosome [BR:dwi03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   TACC proteins
    Dwil_GK14428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1366 aa AA seqDB search
MDLFSKIIKRPLSLAAITTNDDGNSSSTAAGTDVSAATAANLVTTGHPLHLGDRSPLLSL
RDLLDSAAQDINQLEDQHNNLIAMPQQSAASSPSPPSTSSDSIQKLLSAIHVNLNQVSAH
EMEHLQAMSAELSPLAAIKASPKPTMEQPQQKIAALDPLKLGDPSSMIVVPPSPRGVAGG
GLPEFDESQIPELPPFSADMMMAVSGASAVTSLNSTAHDYNSDSDVFVECLSLTSDKRYS
NDPAELEAYTSAINEVLLDEQQNAMQQIDTPSGGNANPADCSYEPMDVDELNATMEILKD
VMAPEDHQLLKEQFMSDVIEKAQLLLSNDPLGETDQTPEDPLKLLNEDHYNDELEASPLT
SSDLLDNDKTQTQEVETNETFGGQEELTAHELESSALKEKHQADESQLAAHELESSALKE
MHQADEQQLNITSDPLGEVPQAPEKQTSQKEEDNIDDIKTKVLDLPENDVDTQNIEIEKI
YVQPVENIPLSPPIPTHRAKTAEELNFLALKELPEDEGSQEKIQKADNEPKVIPIAFVTP
TCMTTMPIGPQTTNNPTFPTSPRSPTFPVQDPAEPPSHFPHSPHAPAETEEMPYLEQAVV
QPSSDRPLSGVIAKMPVSINIIQSSPEEKENKLDINETLPMDEVTSPLPVFNGNSTFSSG
NENEVSASPTVKTAVAAAPLQPTATFSVSLDDVKNESRRTFTANTSPSMDTAVAAAPLQP
TDTFSVPLDDVKNESRRTFTANTGPSMETAVTAAPLQPTDTFSVSLNDDKSESRRTYNVN
NFQEEKQQQLPRRTFFVEDNRQIEENPPVLEQPSVSEKNTRKTFNLESKALEQKSPISTP
HEATEEDDFEPMDVDVSMRSAETPALTRTPSVPICNVQSAPESPPFVSTSPPIPTHQTQQ
LKRVPIHGNTTIVLDEQQLSAKEQATLSASDEKDDVFVEHFGAISPLSDDMFKTPQYTSN
NFAKIQFKEPAPTRTTNRDSRGNIAYAERAVTGERPISDAEFQDGASCNNLIFNSSDFDY
LYTKGNNNAPVDRSSLLLKFDPLLGTPVPVNSLQQQELALSNLLGGNNNNNNNNNRALSP
TLEEHESSGSNQSFAIETSAKSIVKELEFKPPVDRTKKHAKMSVDVIDNDCNKTFDNSNL
NTEDKANNYHNMEELDKKLKNDVTRSEDIEKKLKDAEQREEALIKRITEKDKMNSKLNGV
IEAYEKAIAELISEKEQLVQDYDRQLQEVQTDRDANYHHLTSLETTFSDLHVKYEKSKEM
TLHLRQVEETLLAEKKQTAENLQLQEQRYEKMKSHAMQQLEIANKKLDSCNRERADEVKK
LKALLKKEEVSRVSTAEQLQQKSRENADLLKICEELIYGKGQGGSS
NT seq 4101 nt NT seq  +upstreamnt  +downstreamnt
atggatttattttcgaaaattatcaaacgaccccttagcctggcagcaatcacaacgaat
gacgatggcaacagttcatccacagcagcaggaacagacgtatcagcagcaactgcggca
aatctagtcaccaccggccatccacttcatctaggcgataggtctcctctcttatctcta
cgtgatctactcgattcggctgcccaggatatcaatcaattggaggatcagcataataat
ttaattgcaatgccacaacaatctgctgcctcctcaccatctccaccgtccacgtctagc
gatagtatacaaaaattgctaagcgccattcacgtgaatctaaatcaagttagtgcccat
gaaatggagcatttgcaggccatgagtgcggagttgagtccactggctgcaataaaggca
agtcccaagcctacaatggaacagccacagcaaaagatcgcggcattggatcctcttaag
ctgggtgatccatcatcaatgatagttgttcctccatctccaaggggcgtcgctggtggt
ggtctaccagaatttgatgaaagtcaaattcctgaattgccacctttcagtgcagacatg
atgatggcggtctctggagcttctgctgtgacttctttaaactcgactgctcatgattac
aattcggattcggatgtctttgtggaatgtttgtctttaactagcgataaacgttattca
aacgatcctgccgaactggaagcctatacaagtgcaatcaacgaagtgttgctagacgag
cagcaaaatgccatgcagcagattgatactccaagtggtgggaatgcgaaccctgccgat
tgtagctacgaaccgatggatgtcgatgaactaaatgcaacaatggaaattttaaaagat
gtcatggcaccggaggatcatcagctgttaaaggagcagtttatgagtgatgttatcgag
aaggctcagttacttttaagtaacgatcctcttggagaaacagatcagactcccgaagat
cctcttaaattgttgaatgaagatcattacaatgatgaattagaggcaagtcctttaaca
tcttcagatttgctggataacgataaaacgcaaacgcaagaagtagaaaccaatgaaact
tttggaggacaagaagaattaactgcacatgagttggaatcatcagctcttaaggagaag
catcaggctgatgaatcacaattagctgcacatgagttggagtcatctgctcttaaggag
atgcatcaggcagatgaacaacaattaaatataaccagtgatccacttggagaagtacct
caagcccccgaaaaacagacttcgcaaaaggaagaagacaacattgatgacataaagacg
aaggtcttagatttgcccgaaaacgatgtggacacgcagaacattgaaattgaaaagatt
tatgtgcagcctgtggaaaatattcctctttcacctcccatacccacacatcgggctaaa
actgcagaagaattaaacttcttggctctcaaagagttgcccgaggatgagggatcccaa
gaaaaaatacaaaaggccgataatgaaccaaaagtaataccaattgcctttgttacaccc
acatgtatgactactatgccaattggtcctcagacgaccaacaatcctacctttccgaca
tcacccagatcaccaactttcccagtgcaggatcccgccgaaccaccatcccacttccct
cattctccacatgcacctgcagagacagaggaaatgccctatctagagcaggctgtagtc
cagccatcgagtgaccgtccgttgagtggagtcatagcaaagatgcctgtgtcgattaac
attatacagtcaagccccgaggaaaaggaaaacaagcttgacataaatgaaactttacca
atggatgaggtgacatcacctttgccggtcttcaatggcaactcaactttcagtagtgga
aacgagaatgaagtgagtgccagtccaacagtaaagacagctgtcgctgctgccccactc
caaccaacagctacattttctgtgtccttggatgatgtcaagaatgaatcgcgaagaaca
tttactgcaaatactagcccatctatggatacggctgtggctgctgctccactccagcca
acagatacattttctgtgcccttagatgatgtcaagaatgagtcgcggagaacatttact
gcaaatactggcccatctatggagacggctgtaactgctgctccactccagccaacagat
acatttagtgtatccttgaatgacgacaagagtgagtcgcggagaacatacaatgttaat
aattttcaagaggagaagcagcagcagctgccacgtcgcactttttttgtagaagacaat
cggcagatagaagagaatcctcccgtcttggagcagccgtctgtaagtgagaaaaataca
cgaaaaactttcaacttggagtccaaagcgctagaacaaaaatcacccatttctacaccg
catgaagctaccgaggaagatgattttgaacccatggatgtcgatgtgtccatgcgatca
gccgagacaccagcgctgaccaggacgccatctgttcccatttgcaatgttcaatcggcg
ccggaatctccaccatttgtatcgacatcgcctcccattcccacccaccaaacgcagcag
ctaaagcgtgttcccattcatggcaataccaccatagttttagacgaacaacaactttcg
gccaaagaacaagcaacattgagtgccagtgacgagaaggacgatgtctttgtggagcac
tttggtgccatatcgccgttatcagatgacatgttcaaaacaccgcaatatactagcaac
aattttgccaagatccagtttaaagagcccgcacctacaaggacaaccaacagggatagt
agaggcaacattgcatatgcagagagagcagtaacaggagagagaccgatctctgatgct
gaatttcaagatggtgccagctgtaataatctaatatttaattcatcagatttcgattat
ttatacacaaaaggcaataataatgcgccagtcgatcgtagttcattattattgaaattc
gatccgctgcttggcaccccagtgcccgtcaatagtctccagcagcaggagctagccttg
tcaaatctacttggcggcaataataacaacaacaacaacaataatcgtgccctaagtccc
acattggaggagcacgagtcgagtggaagtaatcaatcgtttgctatagaaacgagtgcc
aaatcgatagtaaaggaattggaatttaagcctcctgtggatagaacaaaaaagcatgca
aaaatgagtgtggacgttattgataacgattgtaacaaaaccttcgataattccaatctc
aatacggaggataaggcaaacaactatcacaacatggaggaattggataagaaattgaaa
aatgatgtaacccgctcagaggatattgaaaagaaactcaaagatgccgaacaacgtgaa
gaagccctaatcaaacgaataacagaaaaggataaaatgaattcaaagctaaacggcgtt
atcgaagcgtatgagaaagccattgctgaactaataagtgaaaaggaacagctagtacag
gattatgacaggcaattacaagaagttcaaacagatcgcgatgcaaattaccatcactta
acgtcgctggaaacgacattctcggatctccatgttaaatatgaaaaaagcaaagagatg
acattacatcttagacaggttgaggagacgctgttggcagaaaagaagcagacagcggag
aatctgcaattgcaagaacagcgctatgagaaaatgaaaagccatgccatgcagcagctg
gaaatagcaaacaaaaagctagatagctgcaatagagagcgtgcagatgaagtgaaaaaa
ctgaaagctttacttaaaaaagaggaagtttcacgtgtctcaacggccgagcaattgcaa
cagaaatctcgtgaaaatgctgatctgcttaagatatgcgaggagcttatctatggcaag
ggacaaggtggtagtagttaa

DBGET integrated database retrieval system