KEGG   Drosophila willistoni: Dwil_GK14592Help
Entry
Dwil_GK14592      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dwi  Drosophila willistoni
Pathway
dwi00040  Pentose and glucuronate interconversions
dwi00053  Ascorbate and aldarate metabolism
dwi00830  Retinol metabolism
dwi00860  Porphyrin and chlorophyll metabolism
dwi00980  Metabolism of xenobiotics by cytochrome P450
dwi00982  Drug metabolism - cytochrome P450
dwi00983  Drug metabolism - other enzymes
dwi01100  Metabolic pathways
Module
dwi_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dwil_GK14592
   00053 Ascorbate and aldarate metabolism
    Dwil_GK14592
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dwil_GK14592
   00860 Porphyrin and chlorophyll metabolism
    Dwil_GK14592
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dwil_GK14592
   00982 Drug metabolism - cytochrome P450
    Dwil_GK14592
   00983 Drug metabolism - other enzymes
    Dwil_GK14592
Enzymes [BR:dwi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dwil_GK14592
Glycosyltransferases [BR:dwi01003]
 Others
  Hydrophobic molecule
   Dwil_GK14592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_1_3
Motif
Other DBs
NCBI-GeneID: 6642677
NCBI-ProteinID: XP_002065589
FlyBase: FBgn0216598
UniProt: B4MWT6
Position
Unknown
AA seq 519 aa AA seqDB search
MLLVPTIVCVLVLGLASPVEIEAGSPLKVLGLFPHPGVSHFHFFYPIMRGLAEAGHDVSV
VSHFPDKNPVAHYKDFPLSGIEKLTNTVDLKMFEKRTFYNHFVEFFLLHDWGKEACNFTL
RSDALQQILKRKQGYFDVIIMEQFNTDCMMGVAHQLQAPVIALSSCVMMPWHYERMGAPI
IPSYIPALFMAQSQDMDFGGRLANWFSFHALNWMYKLISTPVADAMVQYKFGHDVPSVGE
LAKNTSLFFVNQHFSLSGPKPLPPNVIELGGIHIQKAKGLPADLQRLLDNAEHGVILISW
GSMIRANSLTTAKRDGIVRAAARLKQLVIWKWENDTLPNKPDNMHIMKWLPQRDILCHPN
VKVFMTHAGLMGSSEAAYCGVPVVATPMYGDQFLNAAALVQRGMGTLLNFEDISENTVMR
ALKKTLDKSFADAARTVSYSFKHRPQQALQSALWWVEHVANTGGAPLLKPSAVEMSRFVY
YSLDCYVVVGLLLTIIIGSWISLIQRICGSSSSKKTKKD
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggtgcctactatagtttgtgtcctcgtgttgggacttgccagtccagtggag
atcgaagcgggatcccccctcaaagtgctgggtctgtttccccatcccggagtcagtcac
tttcactttttctatcccatcatgcggggattggccgaggcgggacatgatgtcagtgtg
gtgtcccatttccccgacaagaatcctgtggcccactacaaggacttccccctttcgggc
attgagaaactcacaaatactgtggatctaaagatgttcgagaagcgtacattttacaat
cattttgtagagttctttctcctgcacgattggggcaaagaggcgtgtaattttacacta
agatcagatgctttgcaacagatccttaagcgaaaacaaggctacttcgacgtcatcata
atggagcagttcaacacggattgcatgatgggtgtggcccatcaacttcaggcccccgtg
atagccctgagcagctgtgtgatgatgccctggcactacgagcggatgggagctccgatt
ataccctcgtatattccggctctgtttatggcccagtcgcaggatatggattttggtgga
cgtttggccaattggtttagtttccatgccctcaactggatgtacaaattaatctccact
ccagtggcagatgccatggtacaatataaatttggacatgatgtgccctcggtgggtgaa
ttggccaagaatacttcattgtttttcgtgaatcaacacttttcgttgagtggacccaag
cctctgcctccgaatgttatcgaattgggcggaattcacatacaaaaggccaaaggattg
cccgctgatctgcagcgtttgctggacaatgccgagcatggagtaattctcatcagttgg
ggttcgatgatccgcgccaattccttgaccacagccaaacgggatggcattgtgcgagcc
gcagctagactgaagcaactggtgatctggaagtgggagaacgacactctgcccaacaag
ccggataatatgcacatcatgaaatggttgccacagcgcgacattctctgccatcccaat
gtgaaagttttcatgacacatgctggtctcatgggctcatcggaggcggcttattgtggg
gttccagtggtggccacgcccatgtatggcgatcagttccttaacgcagctgccttggtg
caacgtggcatgggcaccttattgaactttgaggatatcagcgaaaacacagttatgcgg
gcactgaagaagactttggacaagagctttgctgatgctgccaggacggtttcctactcc
tttaaacatcgtcctcagcaggccctgcaatcggctttgtggtgggtggagcatgtggcc
aatactggaggagctcccttgttgaaacccagtgccgtcgagatgtctagattcgtctat
tactcactcgattgctatgtggtggttggccttttgctgaccatcattattggcagttgg
atctctttgatccaacgtatttgcggctcaagctcatccaaaaagactaaaaaggattga

DBGET integrated database retrieval system