KEGG   Drosophila willistoni: Dwil_GK14755Help
Entry
Dwil_GK14755      CDS       T01067                                 

Definition
GK14755 gene product from transcript GK14755-RA
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Dwil_GK14755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 681 aa AA seqDB search
MSSEQTIDGAGAAAAAAAGDEPFLGLLDIALLAVLIGGAAFYFLRSRKKEEEPVRSYSIQ
PTTVSTISASDNSFIKKLKASGRSLVVFYGSQTGTGEEFAGRLAKEGIRYRLKGMVADPE
ECDMEELLQLKDISNSLAVFCLATYGEGDPTDNAMEFYEWITNGEVDLTGLNYAVFGLGN
KTYEHYNKVAVYVDKRLEELGANRVFELGLGDDDANIEDDFITWKDRFWPAVCDHFGIEG
GGEEVLIRQYRLLEQPDVQPDRIYTGEIARLHSMQNQRPPFDAKNPFLAPIKVNRELHKG
GGRSCMHIELSIDGSKMRYDAGDHVAMYPINDKSLVEKLGELCKADLDTVFSLINTDTDS
SKKHPFPCPTTYRTALTHYLEITAIPRTHILKELAEYCTDEKEKELLRSMASIAPEGKEK
YQKWIQDACRNVVHILEDIKSCRPPLDHVCELLPRLQPRYYSISSSAKLHPTDVHVTAVL
VEYETPTGRTNKGVATTYLKNKKPQEGGEEVKVPVFIRKSQFRLPTKPETPIIMVGPGTG
LAPFRGFIQERQFLRDEGKEVGDSVLYFGCRKRSEDYIYETELEEWVKKGTLTLKAAFSR
DQEKKIYVQHLLEQDADLIWNVIGEKKGHFYICGDAKNMAVDVRNILVKILSTKGNMSEA
DAVQYIKKMEAQKRYSADVWS
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtgagcaaaccattgatggagctggcgccgctgccgctgcagctgcaggagat
gaaccctttttgggtctactcgatattgccctgttggctgtactaatcggtggggctgcc
ttctatttccttagaagtcgcaagaaggaagaggaaccagttcgtagttattccatacaa
cctaccacagtgagcacaataagtgcatcagataattcgtttatcaagaaactgaaagcc
tccggccgaagtcttgttgtcttctatggctcacagacgggaactggtgaggaatttgcc
ggacgtttggccaaagaaggtatacgctatcgtcttaagggcatggtagctgatcccgag
gaatgcgatatggaggaattgctacaattgaaggatatatccaattcattggctgtcttt
tgtttggccacctatggcgagggtgatcccacagacaatgccatggaattctatgaatgg
ataaccaatggcgaagttgatctaactggtcttaattatgcggtctttggactgggcaac
aagacgtatgagcattataataaggttgctgtctatgtggataagaggctagaggaattg
ggggccaatcgtgtctttgaattgggattgggcgatgatgatgccaacattgaagatgac
tttatcacatggaaggatcgtttctggcccgctgtctgtgatcacttcggcattgagggt
ggcggcgaagaggtgctaatccgtcagtatcgtctacttgaacagcccgatgttcagcca
gatcgcatatatacgggtgaaattgcacgtttgcattctatgcaaaatcaacgtcctccc
tttgatgccaagaatcccttcctggcacccatcaaggtcaatcgggaattgcacaagggc
ggtggacgttcctgcatgcatattgagctcagcatcgatggttccaagatgcgttacgat
gccggtgatcatgttgccatgtatccgattaacgataagagtttggtcgagaaattggga
gaattgtgcaaagccgatttggatacggtattctctttgatcaatactgatacggatagc
agtaagaagcatccattcccctgcccaactacgtatcgcactgccttgactcattatctg
gaaataaccgccataccacgtacacatattctcaaggaattggctgaatactgtacggat
gaaaaggagaaggaactgctgagaagcatggcttccattgccccagaaggcaaggagaaa
tatcaaaaatggattcaggatgcctgccggaatgtggttcatatattggaagatattaaa
tcgtgcaggccgccactggatcacgtgtgcgagttgttgccacgtcttcagccacgttac
tattccatttcatcatcggccaaactgcatcccaccgatgtgcatgtcacggctgtcctt
gtggaatatgaaacacccactggacgcactaacaagggtgtggccaccacttacttgaag
aacaaaaagccccaggagggtggtgaggaggtgaaagttccagttttcataaggaaatca
caattccgtttgcccaccaaaccggagacgccaattattatggttggtcctggtacagga
ttggcaccattccgtggtttcatccaggaacgtcagttcctacgcgacgagggcaaagaa
gtgggtgattcggtgctctatttcggttgccgtaaacgcagcgaagattacatctatgaa
actgaacttgaggaatgggtgaagaagggaaccttgaccctcaaagctgccttttcgcgg
gatcaagagaaaaagatttatgttcaacatttattggaacaggatgctgatctcatatgg
aatgtgattggcgagaagaagggtcacttttacatctgcggtgatgccaagaatatggcc
gttgatgttagaaatattctagtaaaaattctctccaccaaaggcaacatgagcgaagca
gatgccgttcagtatatcaagaaaatggaggcccagaaacgttactcagccgatgtctgg
agctaa

DBGET integrated database retrieval system