KEGG   Drosophila willistoni: Dwil_GK14790Help
Entry
Dwil_GK14790      CDS       T01067                                 

Definition
GK14790 gene product from transcript GK14790-RA
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dwi  Drosophila willistoni
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:dwi00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 390 aa AA seqDB search
MTANSLLGRSILNEGRSNKRSFVSLIVGLVVGFCLAELFVYSSTPERAEFEPYEGHRHGD
VNDAHHSHDMLELSGPEQDVGTHEHVHENSTIAEKLYSEVKILCWIMTNPANHQKKARHV
KRTWGKRCNKLIFMSSAKDDELDAVALPIGEGRNNLWGKTKEAYKYIYANHINDADWFLK
ADDDTYTIVENMRYMLYPYNPETPVYFGCKFKPYVKQGYMSGGAGYVLSKEAVKRFVTEA
IPNPKLCKQDNTGAEDVEIGKCLENVKVLAGDSRDSNGRGRFFPFVPEHHLIPSHTDKKF
WYWQYIFYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLRPYGIINAPDALPNKLAV
GQLMPAPKVSLTEQSTEEASSKVSTDNKTP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaatagcctcctgggacgatcaatattaaatgaagggcgttccaataaacga
tcgtttgtgtccctcattgtgggactggttgtaggcttttgcctggccgaactgtttgtc
tactcttccacgccggaacgtgctgaatttgagccctatgaaggacatcggcatggcgat
gttaacgatgcccatcatagccacgatatgctggagctctctgggcccgaacaggacgtg
ggcacccatgaacatgtccatgagaactcaaccatcgctgagaaactatatagtgaagtt
aaaattttgtgttggattatgaccaatccagccaatcatcagaagaaggcgcgacatgtg
aaacggacatggggcaagcgttgtaataaactcatattcatgagctcggcgaaagatgat
gaattggatgcggtggctctacccattggcgaaggacgcaacaatttgtggggcaagacc
aaagaagcttacaaatatatctatgccaatcatatcaatgatgccgattggttcctcaag
gctgatgatgacacctacacgatagtggagaatatgcgttatatgctttatccctataat
ccagagactccagtttattttggctgcaaattcaagccgtatgtaaagcagggctacatg
tctggaggagctggttatgttctcagcaaagaggcagtcaaacgttttgttaccgaggcc
atacccaatccaaaactttgcaagcaggacaacacgggagctgaagatgtcgaaattgga
aagtgcttggagaacgtaaaagtattagccggagattcacgtgatagcaatggaagagga
agattctttccctttgtgccagaacatcatttgataccgtcgcatacggacaagaagttc
tggtattggcaatatatcttctacaagacggatgagggtttggactgctgttcggataat
gccatatcgtttcactatgtctcccccaatcaaatgtatgtcctggactatctcatctat
catttgaggccgtatggtattataaatgcgcccgatgcattgccaaataaattagctgtg
ggtcaacttatgccggcgcctaaagtttctctcacagagcaatctaccgaggaggcttcc
tcgaaagtttccacagacaacaaaacaccatga

DBGET integrated database retrieval system