KEGG   Drosophila willistoni: Dwil_GK14791Help
Entry
Dwil_GK14791      CDS       T01067                                 

Definition
GK14791 gene product from transcript GK14791-RA
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dwi  Drosophila willistoni
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    Dwil_GK14791
Enzymes [BR:dwi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     Dwil_GK14791
Glycosyltransferases [BR:dwi01003]
 Glycan extension
  Type 3 chain
   Dwil_GK14791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 371 aa AA seqDB search
MTANSLLGRSILNEGRSNKRSFVSLIVGLVVGFCLAELFVYSSTPERAEFEPYEGHRHGD
VNDAHHSHDMLELSGPEQDVGTHEHVHENSTIAEKLYSEVKILCWIMTNPANHQKKARHV
KRTWGKRCNKLIFMSSAKDDELDAVALPIGEGRNNLWGKTKEAYKYIYANHINDADWFLK
ADDDTYTIVENMRYMLYPYNPETPVYFGCKFKPYVKQGYMSGGAGYVLSKEAVKRFVTEA
IPNPKLCKQDNTGAEDVEIGKCLENVKVLAGDSRDSNGRGRFFPFVPEHHLIPSHTDKKF
WYWQYIFYKTDEGLDCSSDNAISFHYITPKHMYVLDYLIYHLRPYGIINAPDALPNKLAV
GQLMPAPKAYD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaatagcctcctgggacgatcaatattaaatgaaggacgttccaataaacga
tcgtttgtgtccctcattgtgggactggttgtaggcttttgcctggccgaactgtttgtc
tactcttcaacgccggaacgtgctgaatttgagccctacgaaggacatcggcatggcgat
gttaacgatgctcatcatagccacgatatgctggagctctctgggcccgaacaggacgtg
ggcacccatgaacatgtccatgagaactcaaccatcgctgagaaactatatagtgaagtt
aaaattttgtgttggattatgaccaatccagccaatcatcagaagaaggcgcgacatgtg
aaacggacatggggcaagcgttgtaataaactcatattcatgagctcggcgaaagatgat
gaattggatgcggtggctctacccattggcgaaggacgcaacaatttgtggggcaagacc
aaagaagcttacaaatatatctatgccaatcatatcaatgatgccgattggttcctcaag
gctgatgatgacacctacacgatagtggagaatatgcgttatatgctttatccctataat
ccagagactccagtttattttggctgcaaattcaagccgtatgtaaagcagggctacatg
tctggaggagctggttatgttctcagcaaagaggcagtcaaacgttttgttaccgaggcc
atacccaatccaaaactttgcaaacaggacaacacgggagctgaagatgtcgaaattgga
aagtgcttggagaatgtaaaagtattagccggagattcacgtgatagcaatggacgggga
agattctttccctttgtgccagaacatcatttgataccgtcgcatacggacaagaagttc
tggtattggcaatatatcttctacaagacggatgagggtttggactgctcttcggataat
gccatatcgtttcactatatcacccccaaacatatgtatgtcctggactatctcatctat
catttgaggccgtatggtattataaatgcgcccgatgcattgccaaataaattagctgtg
ggtcaacttatgccggcgcctaaagcgtatgattaa

DBGET integrated database retrieval system