KEGG   Drosophila willistoni: Dwil_GK14841Help
Entry
Dwil_GK14841      CDS       T01067                                 

Definition
GK14841 gene product from transcript GK14841-RA
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
dwi  Drosophila willistoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 517 aa AA seqDB search
MHSQFVSLLLPLFCLLSSLVAAKTKSSSFIHDDIVEYKDFKKLLRTKNNILALYVSSTKA
AAAELKIFREAGESIRGTGTMLLVDCGLDQEHKKLCKKLKITPDPYTLKHYKDGDYHKDY
DRQMSVASMVTFMRDPSGDLPWEEDPAGKDVVHFSDAGTFTKHLRKDIRPMLVMFHVPWC
GFCKKMKPDYGMAATELKTKGGYVIAAMNVERQENAPIRKLFNITGFPTLIYFENGKLRF
TYEGENTKDALVEFMLNPNAKPAPKAKKPEWSADTNSEIVHLTTQGFEAAVKDEKSVLVM
FYAPWCGHCKRMKPEYEKAALQMKQQNIPGILAALDATKEQAIGEKYKVKSYPTVKYFSH
GVHKFDVNVREASKIVEFMKDPKEPPPPPPPEKNWEEEENAQEVIHFLNDETFSSTLKRK
KHALVMFYAPWCGHCKHTKPEFTAAAISLQDDPRVAFVAVDCTKHSALCAKYNVRGYPTI
LYFSYLKTKVEYNGGRTSKDFISYMNNPPNSNDRSEL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcatagtcagtttgtgtctcttcttctacctcttttctgtttgctgtcgtcacttgtt
gcggcaaaaacaaaatcctcatcatttatacatgatgacatagtcgagtataaagatttc
aagaagctcctgcgtaccaagaacaatattctagctctatatgtgtccagtacgaaagcg
gcggcagccgaattgaaaatctttcgtgaggccggcgaatcaatacgaggaactggtaca
atgttgcttgtggattgtggactggatcaggagcacaagaaattgtgtaaaaaattaaaa
ataacacccgatccttatacattaaaacactacaaggatggagattatcacaaggactat
gatcggcaaatgagtgttgcttcgatggtaacatttatgcgtgatcccagtggtgattta
ccctgggaagaagatccagctggcaaggatgttgtacatttcagtgatgctggcacattc
accaaacatttacgcaaggatataagacccatgctggtgatgttccatgtgccctggtgt
ggtttctgtaagaaaatgaaaccagactatggcatggcggccacagaattaaaaaccaaa
ggcggctatgtgatagcagcaatgaatgtagagcgtcaagagaatgcgcccattagaaaa
ctcttcaatatcacaggttttccaactttgatatattttgaaaatggcaaacttcgtttc
acctatgagggcgagaacactaaagatgctttggtcgagttcatgttgaatcccaatgcc
aagccagcaccaaaagccaaaaaacctgaatggtcagccgatacgaattcggaaattgtt
catcttacgactcagggctttgaggctgctgtaaaggatgagaaatccgttttggttatg
ttctatgccccttggtgtggccattgtaagcgaatgaagccggaatatgaaaaggcagca
ttgcaaatgaaacaacaaaatattcctggaattttggctgctttggatgccaccaaagag
caggcaattggtgaaaagtataaagtgaaaagttatcccaccgttaaatacttttcccat
ggagttcacaaatttgatgtaaatgtgcgtgaggcatcgaaaattgtagaatttatgaaa
gatccaaaagaaccgccaccaccaccgcctccagaaaagaactgggaggaggaggaaaat
gcccaggaggttatacattttctcaacgatgagactttttcatcgactttaaaacgaaaa
aaacatgccttggtcatgttttatgctccctggtgtggacactgtaagcacacaaaacca
gaatttactgctgctgccatttccctacaagatgatcctcgtgtggcttttgttgctgtt
gattgtaccaaacattccgcactctgtgccaaatacaatgtacgtggctatccaactatt
ctatatttctcctatctcaaaacaaaagtggaatacaatggtggacggacgagcaaagat
tttatatcatatatgaacaatccacctaactcaaacgatcgcagtgaattgtga

DBGET integrated database retrieval system