KEGG   Drosophila willistoni: Dwil_GK14853Help
Entry
Dwil_GK14853      CDS       T01067                                 

Definition
GK14853 gene product from transcript GK14853-RA
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dwi  Drosophila willistoni
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dwil_GK14853
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dwil_GK14853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 280 aa AA seqDB search
MVKWIDVLVFGSANIEYITYVTKLPKVGERVEGMYMETSFGGEGANQCVAAAKLGSTVAL
IAKLGKDVAGDDYLNYLSQQGVNVDNVEQLEDSATGMSEIAKSDDGESQIIVVPGANSLL
NAKDVCRCKKVLKDAKVLLCQLEISLKGTLTAMRKFKGVSILNASPLANNWSDDLIKAPT
ILCINKDDAARLTSVDEIKTPEDAKEVANAFLKKGAQSVVITMGDQGAVYLSKKDKNTCK
HVPAPEVRAVADPSGVAKMAARTCSSGSKSTNFVTINNIY
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagtggatagatgtcctggtctttggatcagcaaatattgaatacattacatat
gtaacaaagttgcccaaagttggcgaaagggttgagggtatgtatatggagacatccttc
ggtggggagggggccaatcaatgtgtggctgctgctaaattgggttccactgtcgccttg
attgcaaaactgggcaaggacgtggcaggtgatgactatctaaactatctgagtcagcaa
ggcgtaaatgtcgacaatgtggagcagttggaggactcagcaactggtatgtcagagatt
gctaaatcagatgatggagaaagtcagattattgtcgtacccggtgccaattcgctacta
aacgccaaagatgtgtgtcgctgtaaaaaagttctcaaagatgcaaaagtgcttctttgc
cagctagaaataagcctcaaaggaactttaactgcgatgcgaaaattcaaaggtgtgtct
atattgaatgcatcaccccttgctaataattggtctgacgacttgatcaaagcgccgacg
atcctgtgcattaacaaagatgatgctgctcggcttacatcagtagacgagataaagacg
ccagaggatgccaaagaagtagcaaatgcttttttgaaaaagggtgctcaaagcgttgtt
ataaccatgggcgatcagggtgcagtttatttatcaaagaaagacaaaaacacttgcaaa
cacgtgccggctccagaagttcgggctgttgcagacccatcaggtgtagcaaagatggcc
gccaggacgtgcagcagcggtagcaaaagcactaacttcgtcaccatcaacaacatctac
tag

DBGET integrated database retrieval system