KEGG   Drosophila willistoni: Dwil_GK15007Help
Entry
Dwil_GK15007      CDS       T01067                                 

Definition
GK15007 gene product from transcript GK15007-RA
Orthology
K08738  
cytochrome c
Organism
dwi  Drosophila willistoni
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dwil_GK15007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 108 aa AA seqDB search
MGVPAGDVEKGKKIFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKAATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtaccagctggtgatgttgagaagggcaagaagatcttcgtccaacgttgtgct
cagtgccacaccgttgaggctggtggcaagcacaaggttggacccaatctacatggtctg
attggacgcaagaccggacaggctgccggctttgcctacacagatgccaacaaggccaag
ggtatcacctggaatgaggacacactctttgagtatctggagaatcccaagaaatatatt
cctggcaccaagatgatcttcgctggtctgaagaagcccaatgagcgtggcgatctgatt
gcttacctgaaggcggccaccaagtaa

DBGET integrated database retrieval system