KEGG   Drosophila willistoni: Dwil_GK15100Help
Entry
Dwil_GK15100      CDS       T01067                                 

Definition
GK15100 gene product from transcript GK15100-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dwil_GK15100
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Dwil_GK15100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 724 aa AA seqDB search
MLDRCEMPIQLDNEKLRRDVRLSSSRLDLPQLCNGSRRLDAHNNHVHTNDTTAIVTTTTT
MTSASNNNNNNNNNNIGSPVSSSTTNSSSHGVGNERGSSTKSNSSSGSGSSGNSASSTGS
AELKCNTPMTPSELVKKYRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLG
YDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQ
AVVELNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSM
SLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTY
IQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPP
KVLISVARRRRLFFDSRDAPRCITNTKGRKRAPGSKSLAQILHCQDRYFIDFLQRCLEWD
PAERMTPDEAAHHEFLQPSTSSRHRSCRMSTSSSSSGLNSVSQKSSCYNFAEISPGNGPV
VASITNTTAVSNAAITTKSSSRPLQGHAQSNGHLPDIKLSASDKYNSMQKVAVRSKITSS
VSDLESVQQYSLHRIYGGVGNGGGSTHHVSSAATRKHLNGVGSHGHINNNNSNNNSSKYG
SSTLAHNHHNVTHHNASTATIATTTHHHHHHHAGSGGVNQQSGAGVPHSQSTGDVSDRAI
FGRA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcgatgtgaaatgccgatacagctggacaacgagaagctgagacgcgatgtg
cgtctgtccagttctcgtttggatttgccacaattgtgcaatgggagtcgtcgtttggat
gcccacaacaatcatgtacatacgaatgatacaacggcaattgtaacaacaacaacaaca
atgacatcagcaagcaacaacaacaacaataacaataataacaacattggttcacctgtc
tcatcatcaaccacaaacagcagcagccatggcgtgggcaatgaacgtggctcatccacc
aaatcgaatagcagcagtggcagtggcagctctggcaattcggccagtagcacaggaagt
gctgagctcaaatgcaatacgcccatgacaccatcagagttggttaaaaagtatcgcaac
tatctgaccgatttggaatttgaagagctaaaggtttacaaagaggtctggtattttggc
caacatgccagcaagaactacaataagcccgcccccacagccaataccacaaatttgggc
tacgatgatgataatggcaactacaagatcattgaacacgatcatatagcctttaggtat
gagatattagaggtaattggcaagggaagtttcggtcaggttatacgggccttggatcat
aagaccaatacacatgtggccattaaaattataaggaacaagaagcgttttcttaatcag
gctgtggtcgagctcaatatattggatgagctgcgagaaaaggatgcagatggatctcat
aatgttatacatatgctggattatacatatttccgtaaacatttgtgcattaccttcgag
ttgatgagtctcaatctgtatgaactaatcaagaagaataactataatggttttagcatg
agtcttatacgacgattctgtaattcgatagttaaatgcctgcgtctactctacaaagag
aatataatacactgtgatctcaagccggaaaatatcttgctcaaacaacgtggcagtagc
tcaattaaggtcattgactttggtagctcttgctatgtggatcgcaaaatctatacatat
attcaatctcgcttctatcgctcacctgaggtgattctaggactgcaatatggcacagcc
atcgatatgtggagcttaggctgtattttggcagaattgtatactggatttccactattc
cccggcgaaaatgaggttgagcaattggcctgcattatggaagtattgggattaccaccc
aaggtgctcatctcagtggctcgacgtcgtcgtttgttctttgattcgagagatgcgcca
cgttgcattaccaacacgaagggacgaaaacgggcaccgggtagcaaatctttggcacag
atcctacattgccaggatcggtatttcattgatttcctacagcgttgccttgaatgggat
cccgcggagcgtatgacgcccgatgaggccgcccatcatgaattcctgcagccctccacc
tccagtcgccatcgcagttgccgcatgtcaaccagctcatcgagttcgggtctaaatagt
gtatcccagaaatcgtcgtgctacaacttcgccgagatctcgccgggcaatggtcccgtg
gtcgcgtccataacgaatacgacagcagtgagtaatgcggccattaccacaaagtcatcg
tcgaggccattgcagggacatgcccagtccaatggacacctgcccgatatcaagctgagt
gccagcgacaaatacaatagcatgcaaaaggtagctgttcgctccaagatcacatcaagt
gtctcagatttggaatcggtgcagcaatattcactgcatcgcatctacggaggagtgggc
aatggcggtggtagcactcatcatgtctcatcggcggccacaaggaaacatctcaatggc
gttggcagtcatggccacattaataataataatagcaacaacaattcatccaaatatgga
tcatccaccttggcgcacaatcatcacaatgtgactcatcacaatgcctcgacagcgacc
attgcgacaaccacacatcatcatcaccatcatcatgcgggttcgggtggtgtcaatcag
caatcgggagctggtgtcccacattcacaatccactggcgatgtgtccgacagagccata
tttgggcgtgcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system