KEGG   Drosophila willistoni: Dwil_GK15262Help
Entry
Dwil_GK15262      CDS       T01067                                 

Definition
GK15262 gene product from transcript GK15262-RA
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     Dwil_GK15262
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 337 aa AA seqDB search
MSCNYADGLSPYENKGILGVPENFDNKETVETKCKELAHLVKESSHVVVHTGAGISTSAG
IPDFRGPKGVWTLEEKGEKPLFNTSFNEAKPTRTHMALKALVERGFVQYIVSQNIDGLHL
KSGLSRNYLSELHGNIFIEQCKKCRRQFVRKEAVETVGQKPLEGLTCRAADVGSRSCRSG
FMHDNVLDWEHDLPERDLDLAFMHSTMADLNITLGTTLQIVPSGNLPLKNLKNDGKLVIC
NLQPTKHDKKANLIISSYTDDILSKVCKRLGVEIPEYLEADDPTSPSTTSSLIEWTLQQD
YVKAIEGKFNAHRKATKTKSNHKEFIPKKKLKSNNDD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcaactatgcggatggcctctctccatatgaaaacaaaggaattcttggagtt
cccgagaatttcgataataaagaaactgtagaaactaaatgcaaggagttagcccatctt
gttaaagagtcctcccatgtcgtagtgcataccggcgccggtattagtacatcggctggc
ataccagacttcagaggacctaaaggagtttggactttggaagagaagggagagaaaccg
ctcttcaatacatcatttaatgaagctaaaccaacaaggacacacatggcactaaaggct
cttgtggaaagaggattcgtgcaatatatagttagtcaaaatattgatggccttcattta
aagtctggcttgtcaagaaattacttgtccgagctgcacggtaatatattcatcgagcag
tgtaaaaaatgtcggagacagttcgtacgcaaagaagccgtggagactgtgggtcaaaag
cctttagagggactcacctgcagagcagccgatgtaggcagtagaagttgtcgttctgga
tttatgcatgataatgttttagattgggagcacgatttgcccgaacgtgatttagatttg
gcatttatgcactcaacaatggccgatttaaacataactctgggaactactttgcaaatt
gttccaagcggaaatttgccgcttaagaacctaaaaaatgatggcaaacttgtcatatgt
aacttacagccaacaaaacatgataagaaagcgaatctcattatatcttcctacactgat
gatatcctgtccaaggtgtgcaaaagattaggcgttgaaattccggaatatttggaggca
gatgatccgacaagcccaagtacaacatcatccttaatagaatggacattacagcaagat
tatgtaaaggcaatagaaggaaaatttaatgctcatcgaaaagcaacaaagacaaaaagt
aatcataaagaatttattccaaaaaagaagcttaaatccaataatgatgactaa

DBGET integrated database retrieval system