KEGG   Drosophila willistoni: Dwil_GK15310Help
Entry
Dwil_GK15310      CDS       T01067                                 

Definition
(RefSeq) GK15310 gene product from transcript GK15310-RB
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
dwi  Drosophila willistoni
Pathway
mTOR signaling pathway
Longevity regulating pathway - multiple species
Jak-STAT signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    Dwil_GK15310
   04150 mTOR signaling pathway
    Dwil_GK15310
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dwil_GK15310
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    Dwil_GK15310
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dwil_GK15310
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Dwil_GK15310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 2447 aa AA seqDB search
MSTSSSVVQQFVNGLKSRNRNVQNKATQDLFLYCKTELREMSQEELAQFFDEFDHHIFNM
VNAADINEKKGGALAMKCLISSDHWTTRNGISPYLNRLRDLLLINDVSVMEIAARSLVKL
ANMPGSKGVDSFDFDIKKAFEMLSGDRQEYRRHAAVFILRELAIALPTYFYQQILTFFEH
IFNAIFDPKPAIRKSAAEALCAALIVTAQRENTKQSSEPQWYQMCYDEANYHFQYDSGGA
KEQKGMTRDDRIHGSLIVFNELFRCANSSWERRYNSLKTLFPKPHSNKFLEAGTSSTVSA
QLTTIVPRIKVPFIDKLGTGTQMHLEHSEQHNGMSNKFSSQNVVESAYAHEILAEHYVTI
CDNVFEQCFSKSPYVQQGLLQILPRLAAFNREVFVQKYLRRCVSYLMNTLPGKGKDRTVA
HITMGYIAVAVERDIEEHLKPIMATIKVALPAKDLASKRKLPVDPAVFACITLLAHAVKS
EIADDVKDILEQMFYTGLSPALTVCLRELAENVPQLKPRITEGLIGVLYQVLMNKPAAIP
YAVMTPIAIDASLMLQTTDTSTIVLALKTLGTFNFEEQNMLDFVRRCADFFIVHEQQEIR
LEAVQSCTRLLKLAVQAADSMENSKTLSDTVSHVIERLLMVAITDMDCNVRIRILRSLDE
TFDAKLAQPESLNSLFITLHDEIFEIRELAMVTIGRLSSMNPAYVMPKLRTTMIELLTDL
KYSGMSRNKEQSARMLDHLVISTPRLISSYMNPILKALVPKLHEPESNQGVILNVLRTIG
DLAEVNGGCNEMELWADELLSILLEMLGDAGSPDKRGVALWTLGQLISATGRVVTPYHKY
PVLIDILINFLKTEQRKSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYSDGK
VDENQDISTAELLVNMGNALDEYYPAVAIAALMRILRDPTLSAYHTSVVQAVTFIFQSLG
IKCVPYLAQVLPNLLDNVRTADNKLREFLFQQLAILVAFVKLHIISYMGDIFKLIKEFWT
INTPLQSTLINLIEQIAVALGCEFRDYLAQLIPQILRVLHHDNSKDRIVTRKLLQALQKF
GSTLGYYLPLIIPPIVKLFDSPYVPKQVSMVALETINNLACQLDFTDFSSRIIHPLVRVL
DTEPELREQAMITLRSLVKQLGKKYLVFVPMVQRTLTKHRIVDGEYEKLLTRLQSQSTLV
EEFGLRQTKIKKNEPFMPDRGNISSTNLKVSTNQLRSAWQVTRRVSKDDWIEWLKRLSIG
LLKESPSHALRACCNLAQDYDTLLRDLFNAAFISCWTELSAEHKNELTQSLIQALQVTDM
PEITQTILNLAEFMEHCDRDPIPIETKLLGTRAMACRAYAKALRYKEEEFLLREDPQVFE
SLILINNKLQQREAAEGLLTTYRNAANELNVQGRWYEKLHNWDQALEHYKYSLGQDSSDL
EARLGHMRCLEALGDWTELSNVTKHEWDTFGSEARARASPLAAVAAWGLQDWEAMQEYVR
CIPVDTQDGSYYRAVLAVHHDDYETAQRLIDETRDLLDTELTSMAGESYERAYGAMVCVQ
MLAELEEVIQYKLIPERREPLKAMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHEDIHTWL
KYASLCRKSGSLHLSHKTLVMLLGTDPKLAPKESLPCHQPQVTYAYTKYMAASDQLPQAY
EQLRRFVNTYNAQLPPEALNQQDQRLMARCYLRLATWQNKLQEPVVKDAIQKALDYYEKA
TTYDPNWYKAWHLWAYMNFKVVQGQKQSLDKQQHQPQPLQSLGLNLGLGGGMDSEHFIIQ
QYAVPAVQGFFRSISLIKGNSLQDTLRLLTLWFDYGHHAEVYEALLSGMKLIEINTWLQV
IPQLIARIDTHRKLVGQLIHQLLMDIGKNHPQALVYPLTVASKSASLARKNAAFKILDSM
RKHSPILVEQAVMCSEELIRVAILWNEQWHKGLEVASRLYFVDQNIKEMIDVLDELHAML
DRGPETPEEISFTQTFGEDLAEACEWIQQYKISGVQTDLDNAWNIYKYVYWNTEPNQLSS
FELSHVSPKLLSCKDLELAVPGSYHPGHELIRINCVSSDLQVIKSKQRPKRLSIKGSNGK
YYRYLLKAHDDLRLDERAMQLFSLINTLLLTNPDTFRHNLTIQRYAVIPLSTNSGLIGLV
PHCDTLHRLISDYRERKGEQLNQELSTIYKFAPDYDRLTVMQKVEVFEYTLSRFSGNDLA
KLLWLKSPSTEHWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMNGKILHIDFGD
CFEVAMLREAVPEKVPFRLTRMLIKAMEVTGIEGTYRRTCESVMVVLRRNKDSLMAVLEA
FVYDPLLNDSLFVVNRRVPENNWSNAGGFTEDGANTENRSISVESPIQQEADTKASQIIK
RVDSKLTGTDFENQGPVNEQQQVDLLIQQATNNENLCQGHIGWCPFW
NT seq 7344 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctcatcgtcggtagtgcaacaatttgtaaacgggcttaagtcccgcaatcgc
aatgtccagaacaaggctacacaggatttgttcctgtattgcaagaccgaattgcgggag
atgtcccaggaggagttggcccagttctttgatgaattcgatcaccatatatttaatatg
gtcaatgcagcagatatcaatgagaaaaaaggcggagcattagccatgaagtgcctcatt
agcagtgatcactggacaaccaggaatggcatttcaccatatttaaatcgtctcagagac
ctgctcctgatcaatgatgtttcagttatggagattgccgcccgttcactagtcaaactg
gccaatatgccgggctccaagggtgtggattcctttgattttgatattaaaaaagctttc
gagatgctaagtggtgatagacaagagtatcgccgccatgctgccgtctttatcctgcgg
gagttggccattgctttgccaacatatttctatcaacaaattcttacgttctttgaacat
atattcaatgcaattttcgatccgaagccggcaatacgaaaatctgctgccgaggcattg
tgtgccgctcttattgtcactgctcagcgagagaataccaaacagtccagtgaaccacaa
tggtatcaaatgtgctacgatgaggcgaattatcattttcaatatgattcgggaggtgcc
aaggagcagaaaggaatgactcgagatgaccgcatccatggcagtctaattgtgttcaat
gagctctttcgttgtgccaattctagttgggagcgtcgatataactcactcaaaacgctg
ttccccaaaccgcatagcaacaaattcctggaagccggcacctcttcaacggtgagcgcg
cagttgactacaattgtaccacggataaaggtaccctttatcgataagctggggactggc
acacagatgcatctggagcatagcgagcaacataatggaatgtccaataaattttccagt
caaaacgtcgttgaatcagcctatgcccatgagattctagcagagcactatgtgaccatc
tgtgacaatgtgttcgagcagtgtttctcgaaatcgccatatgtgcaacaaggactactg
cagatccttccacgcttggctgccttcaatcgagaggtctttgtgcagaaatatttgcga
agatgtgtttcctacctcatgaatacattgccaggaaaagggaaggatcgaactgttgcc
cacataaccatgggatacatcgctgtggcggtggagcgggacattgaggaacatctgaag
cccattatggccaccattaaagtggccctgccagctaaagatttggccagcaagcgtaaa
ttgcctgttgatccggccgtgtttgcatgcatcactctgctagctcatgcagtgaaatca
gaaatagccgacgacgttaaagatatcctggagcaaatgttttacactggcctttcgccg
gcgttgacagtttgcttgcgtgaactggccgaaaatgtgcctcagctgaaaccaaggatt
accgagggtctaatcggagtcctctatcaggtgctgatgaataagccggccgccataccc
tacgccgtcatgactcccatagctattgatgcttcacttatgctacaaaccacggatact
tccaccatagtcctggccctcaagactctagggacgtttaatttcgaagagcagaatatg
ttggatttcgtaagaagatgcgcggacttttttatagtgcatgaacagcaggagatacgc
ctggaggctgtacagtcatgtacacgccttctgaaactggctgttcaggcagccgattcc
atggagaactccaagactttgagcgacactgtgtcgcatgtgattgaacgtctacttatg
gtggccatcaccgatatggattgcaacgttcgaatacggatcctgcgatcgctcgacgag
acttttgatgcgaaactagctcagccagagtccttgaattcgctgtttatcactctgcat
gatgagatctttgagatacgggaactggccatggtcaccattggccgtttatcctccatg
aacccagcctatgtgatgccgaagctgaggaccaccatgatcgagttactcaccgacttg
aaatactccggaatgagtcgaaacaaagaacaaagtgctagaatgttggatcatttggtt
atcagtacaccacgattgatatcttcgtacatgaatcccatattgaaggctttggtgccc
aaactacatgaaccggagtccaatcagggtgtgatcctgaatgtcctgagaacgatagga
gatttggctgaggtaaatggaggctgcaatgagatggaactgtgggctgatgagctgctg
tcgattctgctcgaaatgttgggtgatgctggtagtccggacaaacgtggtgtggccctt
tggactttgggtcaactgattagtgccacgggtcgagtagtaaccccatatcacaaatat
cctgtcctcattgacattttgattaattttctaaaaaccgagcaaaggaaatcgatacgc
cgggaaacgattcgagtcttgggattgctgggagccatggatccgtacaaacacaaaatg
aacaaaggcctgatagacagccaaaaggataatgtattgatagcctattccgatggcaaa
gtggatgaaaatcaggatatatcaacagctgagctgctggtgaacatgggcaatgcgttg
gatgaatactatccagctgtggccattgccgcactgatgcgtattctgcgagatcccacc
ctaagtgcctaccacaccagtgtggtgcaggctgtaacctttatattccaatcgttgggc
atcaagtgtgttccgtacttggcgcaggttctgccgaatcttttggacaatgtgcgaacg
gcggataacaagcttcgagagtttctattccaacaattggctatattggtggcctttgtc
aagcttcatattatcagctatatgggagacattttcaagttgatcaaggaattctggaca
ataaacaccccactgcaatccacactaatcaatctgatagaacaaatcgctgtggctttg
ggctgcgagttccgggattatctagcccaattaataccccagatattgagggtacttcat
cacgataattccaaggatcggatagtaacccgaaaactgctacaggcccttcagaaattc
gggagcacgttgggctattacttgccgctgataattcctccgatagtgaagctattcgac
tcaccgtatgtgccgaagcaggtgtcaatggtggccctggagacgatcaataatctggct
tgtcaactggactttacggatttctcttcccgaatcattcatccgttggtgagggtgtta
gatacggagccagaactccgggagcaggccatgattacactacgctctttggtgaaacag
ttgggcaaaaaatatttggtctttgtgcccatggtgcagcgcaccctgactaaacaccgt
atcgtggatggcgaatatgagaaactgttgacgcgtctacaatcccaaagcactttggtg
gaagaatttggactgcggcaaaccaagattaagaagaacgagccattcatgcccgataga
ggcaatatcagcagcaccaatttgaaggtctccacaaaccaacttcgatctgcttggcag
gtcactcgccgagtatccaaagatgattggattgagtggcttaaacgtttgtctattggc
cttctgaaggagtctccgtcgcatgcattgcgagcctgctgtaacctggcccaggattat
gacactttgctaagggatttgttcaatgctgccttcatttcctgctggacagaattgtca
gctgagcataaaaatgagcttacccaatcgttgatccaagccctgcaggtcaccgatatg
ccagagataacccagaccattttgaatctggcggagttcatggagcattgcgaccgcgat
cccataccaattgaaaccaagctattaggaacccgcgccatggcctgcagggcctatgcc
aaggctttgcgatacaaggaagaagagtttcttctacgagaagatcctcaggttttcgag
tccttgattttgatcaacaacaaactgcaacagagagaagctgcagaaggtctcctaacc
acctatcgtaacgccgccaacgagcttaatgtccagggacgttggtacgagaaactacac
aactgggatcaggcattggaacactataaatacagcttgggccaagattcgtccgacttg
gaggctcgtctgggccacatgcgctgccttgaggccttgggagattggacagaactaagc
aatgtgacgaaacatgaatgggacacctttggttcagaggccagggcgagggccagcccg
ctggctgccgtagctgcttggggtctacaagattgggaggccatgcaggagtatgtccgt
tgcataccagtggacacgcaagatggtagctattatcgtgccgttctagccgtgcatcat
gatgattacgaaaccgcccagagattaattgatgagacgagagatttgctggacactgaa
ctgacctccatggctggcgagtcctacgaacgggcctacggagcaatggtatgcgtccaa
atgttggcggaacttgaggaggtcatacaatacaaactgatacccgagagacgagaaccc
ctaaaggccatgtggtggaaacgtttgcaggggggccaaaggctggtggaagattggcgc
cggattatccaggtgcattcgttggtggtgaagccacacgaggatatacacacctggctg
aaatatgcctcactttgccgcaaatccggttcactgcatttatcgcacaagactcttgtg
atgctactcggaacagatcctaaactggcaccgaaggaatctttgccctgccatcagcca
caagtaacctatgcctataccaaatatatggctgcatcggatcaattgcctcaagcttat
gagcaattgcgtcggtttgtcaacacttacaatgcgcaattgccgccggaggctctgaat
caacaggatcagcggttgatggccaggtgctatcttcgcctagccacctggcagaataag
ttgcaggaaccggtggtgaaggatgccatacaaaaggctctggattactatgaaaaggcc
accacgtatgaccccaattggtacaaagcttggcatttgtgggcctacatgaatttcaag
gtggttcaagggcagaagcagagcctggataagcagcaacatcaaccacaacctctgcaa
agcttgggcctgaacttgggattgggtggtggcatggatagtgagcattttattatccaa
caatacgcagtgccagctgtgcaaggatttttccgctccatcagtctgatcaagggcaat
tctctgcaggatactttacggctgctcactttgtggtttgattatggtcatcatgccgag
gtttacgaggcgttgctctctggcatgaagctgatagagattaatacgtggctccaggtc
atacctcagttgattgcacgcattgatacacacaggaagctcgtgggacaacttatccat
cagcttctgatggatataggaaagaatcatcctcaagctttggtctatccgttgacggtg
gcttccaaatcggcatcattggccagaaagaatgctgctttcaagattttggactccatg
agaaagcattctcccattttggtcgagcaggcggtaatgtgcagcgaggaacttattaga
gttgccattctatggaacgagcagtggcataagggattggaggtggcttcgcgtctatat
tttgttgatcagaatataaaagaaatgatcgatgtactggatgaattgcatgccatgctg
gatcgtggtccagaaacacctgaagagatctcatttacgcaaacgtttggagaagaccta
gccgaggcctgtgaatggatacagcaatacaagatttcaggagtgcaaacagatctagat
aatgcctggaatatatacaaatatgtgtactggaatacagaacctaaccagttgtcgtca
tttgaattgtcccatgtgtcgcctaaattgttgagctgcaaggatttggagttagccgta
ccaggctcatatcatccagggcacgagttaatacgcataaattgtgttagctctgatctt
caggtaatcaaatctaagcagcgacccaaacgactctccattaaaggctcaaatggcaag
tattacaggtatttgctaaaggcacacgatgatctccgtctcgatgagcgtgcaatgcag
ttgttctcattgatcaacacattgctgctgaccaatccggatacctttcgtcataatttg
accattcaaagatatgcagtgattccgctaagtacaaattctggtctaattggcctggtt
ccacattgtgatacgcttcatcggctgatctccgattatagggaaagaaaaggagagcaa
ctgaatcaagaactttccactatttacaaatttgcaccagattatgatcgcctcacagta
atgcaaaaggtcgaagtgtttgaatatactttgagccgtttctctggcaatgatttggcc
aaattgctatggctgaaaagtccctcaacggaacactggttcgagaggcgcaataattac
actcgttcgctggctgtcatgtccatggtgggatacatcttaggactgggtgatcggcat
ccttctaatttaatgttagatcgtatgaatggaaaaattttacatatagatttcggtgac
tgcttcgaggtggccatgttaagagaggcagttccagagaaagttccttttcgtctcacc
cgtatgctgatcaaggccatggaggtcactggcatagagggcacctatcgcagaacttgt
gaaagtgtcatggtggtcctcagacgcaacaaggactctctaatggcagtgctcgaagct
ttcgtctatgatcctctgctgaatgatagtctgtttgttgtgaatagaagggttcctgag
aacaattggtcaaatgccggaggtttcactgaagatggagcaaacactgagaatagatca
attagtgtggagtctccaatccaacaggaagctgataccaaggctagccaaattattaaa
cgtgtcgatagcaaacttactggcaccgattttgaaaaccaaggaccagtcaatgagcag
caacaagtagatctccttatacagcaggcaaccaacaatgagaacctctgccagggccac
attggctggtgtccattctggtaa

DBGET integrated database retrieval system