KEGG   Drosophila willistoni: Dwil_GK15310Help
Entry
Dwil_GK15310      CDS       T01067                                 

Definition
GK15310 gene product from transcript GK15310-RA
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dwi  Drosophila willistoni
Pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dwi04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2869 aa AA seqDB search
MSTSSSVVQQFVNGLKSRNRNVQNKATQDLFLYCKTELREMSQEELAQFFDEFDHHIFNM
VNAADINEKKGGALAMKCLISSDHWTTRNGISPYLNRLRDLLLINDVSVMEIAARSLVKL
ANMPGSKGVDSFDFDIKKAFEMLSGDRQEYRRHAAVFILRELAIALPTYFYQQILTFFEH
IFNAIFDPKPAIRKSAAEALCAALIVTAQRENTKQSSEPQWYQMCYDEANYHFQYDSGGA
KEQKGMTRDDRIHGSLIVFNELFRCANSSWERRYNSLKTLFPKPHSNKFLEAGTSSTVSA
QLTTIVPRIKVPFIDKLGTGTQMHLEHSEQHNGMSNKFSSQNVVESAYAHEILAEHYVTI
CDNVFEQCFSKSPYVQQGLLQILPRLAAFNREVFVQKYLRRCVSYLMNTLPGKGKDRTVA
HITMGYIAVAVERDIEEHLKPIMATIKVALPAKDLASKRKLPVDPAVFACITLLAHAVKS
EIADDVKDILEQMFYTGLSPALTVCLRELAENVPQLKPRITEGLIGVLYQVLMNKPAAIP
YAVMTPIAIDASLMLQTTDTSTIVLALKTLGTFNFEEQNMLDFVRRCADFFIVHEQQEIR
LEAVQSCTRLLKLAVQAADSMENSKTLSDTVSHVIERLLMVAITDMDCNVRIRILRSLDE
TFDAKLAQPESLNSLFITLHDEIFEIRELAMVTIGRLSSMNPAYVMPKLRTTMIELLTDL
KYSGMSRNKEQSARMLDHLVISTPRLISSYMNPILKALVPKLHEPESNQGVILNVLRTIG
DLAEVNGGCNEMELWADELLSILLEMLGDAGSPDKRGVALWTLGQLISATGRVVTPYHKY
PVLIDILINFLKTEQRKSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYSDGK
VDENQDISTAELLVNMGNALDEYYPAVAIAALMRILRDPTLSAYHTSVVQAVTFIFQSLG
IKCVPYLAQVLPNLLDNVRTADNKLREFLFQQLAILVAFVKLHIISYMGDIFKLIKEFWT
INTPLQSTLINLIEQIAVALGCEFRDYLAQLIPQILRVLHHDNSKDRIVTRKLLQALQKF
GSTLGYYLPLIIPPIVKLFDSPYVPKQVSMVALETINNLACQLDFTDFSSRIIHPLVRVL
DTEPELREQAMITLRSLVKQLGKKYLVFVPMVQRTLTKHRIVDGEYEKLLTRLQSQSTLV
EEFGLRQTKIKKNEPFMPDRGNISSTNLKVCRTDQLRSAWQVTRRVSKDDWIEWLKRLSI
GLLKESPSHALRACCNLAQDYDTLLRDLFNAAFISCWTELSAEHKNELTQSLIQALQVTD
MPEITQTILNLAEFMEHCDRDPIPIETKLLGTRAMACRAYAKALRYKEEEFLLREDPQVF
ESLILINNKLQQREAAEGLLTTYRNAANELNVQGRWYEKLHNWDQALEHYKYSLGQDSSD
LEARLGHMRCLEALGDWTELSNVTKLEWDTFGSEARARASPLAAVAAWGLQDWEAMQEYV
RCIPVDTQDGSYYRAVLAVHHDDYETAQRLIDETRDLLDTELTSMAGESYERAYGAMVCV
QMLAELEEVIQYKLIPERREPLKAMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHEDIHTW
LKYASLCRKSGSLHLSHKTLVMLLGTDPKLAPKESLPCHQPQVTRRVSKDDWIEWLKRLS
IGLLKESPSHALRACCNLAQDYDTLLRDLFNAAFISCWTELSAEHKNELTQSLIQALQVT
DMPEITQTILNLAEFMEHCDRDPIPIETKLLGTRAMACRAYAKALRYKEEEFLLREDPQV
FESLILINNKLQQREAAEGLLTTYRNAANELNVQGRWYEKLHNWDQALEHYKYSLGQDSS
DLEARLGHMRCLEALGDWTELSNVTKHEWDTFGSEARARASPLAAVAAWGLQDWEAMQEY
VRCIPVDTQDGSYYRAVLAVHHDDYETAQRLIDETRDLLDTELTSMAGESYERAYGAMVC
VQMLAELEEVIQYKLIPERREPLKAMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHEDIHT
WLKYASLCRKSGSLHLSHKTLVMLLGTDPKLAPKESLPCHQPQVTYAYTKYMAASDQLPQ
AYEQLRRFVNTYNAQLPPEALNQQDQRLMARCYLRLATWQNKLQEPVVKDAIQKALDYYE
KATTYDPNWYKAWHLWAYMNFKVVQGQKQSLDKQQHQPQPLQSLGLNLGLGGGMDSEHFI
IQQYAVPAVQGFFRSISLIKGNSLQDTLRLLTLWFDYGHHAEVYEALLSGMKLIEINTWL
QVIPQLIARIDTHRKLVGQLIHQLLMDIGKNHPQALVYPLTVASKSASLARKNAAFKILD
SMRKHSPILVEQAVMCSEELIRVAILWNEQWHKGLEVASRLYFVDQNIKEMIDVLDELHA
MLDRGPETPEEISFTQTFGEDLAEACEWIQQYKISGVQTDLDNAWNIYKYVYWNTEPNQL
SSFELSHVSPKLLSCKDLELAVPGSYHPGHELIRINCVSSDLQVIKSKQRPKRLSIKGSN
GKYYRYLLKAHDDLRLDERAMQLFSLINTLLLTNPDTFRHNLTIQRYAVIPLSTNSGLIG
LVPHCDTLHRLISDYRERKGEQLNQELSTIYKFAPDYDRLTVMQKVEVFEYTLSRFSGND
LAKLLWLKSPSTEHWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMNGKILHIDF
GDCFEVAMLREAVPEKVPFRLTRMLIKAMEVTGIEGTYRRTCESVMVVLRRNKDSLMAVL
EAFVYDPLLNDSLFVVNRRVPENNWSNAGGFTEDGANTENRSISVESPIQQEADTKASQI
IKRVDSKLTGTDFENQGPVNEQQQVDLLIQQATNNENLCQGHIGWCPFW
NT seq 8610 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctcatcgtcggtagtgcaacaatttgtaaacgggcttaagtcccgcaatcgc
aatgtccagaacaaggctacacaggatttgttcctgtattgcaagaccgaattgcgggag
atgtcccaggaggagttggcccagttctttgatgaattcgatcaccatatatttaatatg
gtcaatgcagcagatatcaatgagaaaaaaggcggagcattagccatgaagtgcctcatt
agcagtgatcactggacaaccaggaatggcatttcaccatatttaaatcgtctcagagac
ctgctcctgatcaatgatgtttcagttatggagattgccgcccgttcactagtcaaactg
gccaatatgccgggctccaagggtgtggattcctttgattttgatattaaaaaagctttc
gagatgctaagtggtgatagacaagagtatcgccgccatgctgccgtctttatcctgcgg
gagttggccattgctttgccaacatatttctatcaacaaattcttacgttctttgaacat
atattcaatgcaattttcgatccgaagccggcaatacgaaaatctgctgccgaggcattg
tgtgccgctcttattgtcactgctcagcgagagaataccaaacagtccagtgaaccacaa
tggtatcaaatgtgctacgatgaggcgaattatcattttcaatatgattcgggaggtgcc
aaggagcagaaaggaatgactcgagatgaccgcatccatggcagtctaattgtgttcaat
gagctctttcgttgtgccaattctagttgggagcgtcgatataactcactcaaaacgctg
ttccccaaaccgcatagcaacaaattcctggaagccggcacctcttcaacggtgagcgcg
cagttgactacaattgtaccacggataaaggtaccctttatcgataagctggggactggc
acacagatgcatctggagcatagcgagcaacataatggaatgtccaataaattttccagt
caaaacgtcgttgaatcagcctatgcccatgagattctagcagagcactatgtgaccatc
tgtgacaatgtgttcgagcagtgtttctcgaaatcgccatatgtgcaacaaggactactg
cagatccttccacgcttggctgccttcaatcgagaggtctttgtgcagaaatatttgcga
agatgtgtttcctacctcatgaatacattgccaggaaaagggaaggatcgaactgttgcc
cacataaccatgggatacatcgctgtggcggtggagcgggacattgaggaacatctgaag
cccattatggccaccattaaagtggccctgccagctaaagatttggccagcaagcgtaaa
ttgcctgttgatccggccgtgtttgcatgcatcactctgctagctcatgcagtgaaatca
gaaatagccgacgacgttaaagatatcctggagcaaatgttttacactggcctttcgccg
gcgttgacagtttgcttgcgtgaactggccgaaaatgtgcctcagctgaaaccaaggatt
accgagggtctaatcggagtcctctatcaggtgctgatgaataagccggccgccataccc
tacgccgtcatgactcccatagctattgatgcttcacttatgctacaaaccacggatact
tccaccatagtcctggccctcaagactctagggacgtttaatttcgaagagcagaatatg
ttggatttcgtaagaagatgcgcggacttttttatagtgcatgaacagcaggagatacgc
ctggaggctgtacagtcatgtacacgccttctgaaactggctgttcaggcagccgattcc
atggagaactccaagactttgagcgacactgtgtcgcatgtgattgaacgtctacttatg
gtggccatcaccgatatggattgcaacgttcgaatacggatcctgcgatcgctcgacgag
acttttgatgcgaaactagctcagccagagtccttgaattcgctgtttatcactctgcat
gatgagatctttgagatacgggaactggccatggtcaccattggccgtttatcctccatg
aacccagcctatgtgatgccgaagctgaggaccaccatgatcgagttactcaccgacttg
aaatactccggaatgagtcgaaacaaagaacaaagtgctagaatgttggatcatttggtt
atcagtacaccacgattgatatcttcgtacatgaatcccatattgaaggctttggtgccc
aaactacatgaaccggagtccaatcagggtgtgatcctgaatgtcctgagaacgatagga
gatttggctgaggtaaatggaggctgcaatgagatggaactgtgggctgatgagctgctg
tcgattctgctcgaaatgttgggtgatgctggtagtccggacaaacgtggtgtggccctt
tggactttgggtcaactgattagtgccacgggtcgagtagtaaccccatatcacaaatat
cctgtcctcattgacattttgattaattttctaaaaaccgagcaaaggaaatcgatacgc
cgggaaacgattcgagtcttgggattgctgggagccatggatccgtacaaacacaaaatg
aacaaaggcctgatagacagccaaaaggataatgtattgatagcctattccgatggcaaa
gtggatgaaaatcaggatatatcaacagctgagctgctggtgaacatgggcaatgcgttg
gatgaatactatccagctgtggccattgccgcactgatgcgtattctgcgagatcccacc
ctaagtgcctaccacaccagtgtggtgcaggctgtaacctttatattccaatcgttgggc
atcaagtgtgttccgtacttggcgcaggttctgccgaatcttttggacaatgtgcgaacg
gcggataacaagcttcgagagtttctattccaacaattggctatattggtggcctttgtc
aagcttcatattatcagctatatgggagacattttcaagttgatcaaggaattctggaca
ataaacaccccactgcaatccacactaatcaatctgatagaacaaatcgctgtggctttg
ggctgcgagttccgggattatctagcccaattaataccccagatattgagggtacttcat
cacgataattccaaggatcggatagtaacccgaaaactgctacaggcccttcagaaattc
gggagcacgttgggctattacttgccgctgataattcctccgatagtgaagctattcgac
tcaccgtatgtgccgaagcaggtgtcaatggtggccctggagacgatcaataatctggct
tgtcaactggactttacggatttctcttcccgaatcattcatccgttggtgagggtgtta
gatacggagccagaactccgggagcaggccatgattacactacgctctttggtgaaacag
ttgggcaaaaaatatttggtctttgtgcccatggtgcagcgcaccctgactaaacaccgt
atcgtggatggcgaatatgagaaactgttgacgcgtctacaatcccaaagcactttggtg
gaagaatttggactgcggcaaaccaagattaagaagaacgagccattcatgcccgataga
ggcaatatcagcagcaccaatttgaaggtctgtcggacagaccaacttcgatctgcttgg
caggtcactcgccgagtatccaaagatgattggattgagtggcttaaacgtttgtctatt
ggccttctgaaggagtctccgtcgcatgcattgcgagcctgctgtaacctggcccaggat
tatgacactttgctaagggatttgttcaatgctgccttcatttcctgctggacagaattg
tcagctgagcataaaaatgagcttacccaatcgttgatccaagccctgcaggtcaccgat
atgccagagataacccagaccattttgaatctggcggagttcatggagcattgcgaccgc
gatcccataccaattgaaaccaagctattaggaacccgcgccatggcctgcagggcctat
gccaaggctttgcgatacaaggaagaggagttccttctacgggaagatcctcaggttttc
gagtccttgattttgatcaacaacaaactgcaacaaagggaagctgcagaaggtctcctt
accacctatcgtaacgccgccaacgagcttaatgtccagggacgttggtacgagaagcta
cacaactgggatcaggcgttggaacactataaatacagcttgggccaagattcgtccgac
ttggaggctcgcctgggccacatgcgttgccttgaggccttgggagattggacagaacta
agcaatgtgacgaaacttgaatgggacaccttcggttcagaggccagggcgagggccagc
ccgctggctgccgtagctgcttggggtctacaagattgggaggccatgcaggagtatgtc
cgttgtataccagtggacacgcaagatggtagctattatcgtgccgttctagccgtgcat
cacgatgattacgaaaccgcccagagattaattgatgaaaccagagatttgctggacact
gaactgacctccatggccggcgagtcctacgaacgggcctacggagcaatggtatgcgtc
caaatgttggcggaacttgaggaggtcatacaatacaaactgatacccgagagacgagaa
cccctaaaggccatgtggtggaaacgtttgcaggggggccaaaggctggtggaagattgg
cgccggattatccaggtgcattctttggttgtgaagccacacgaggatatacacacctgg
ctgaaatatgcgtcactgtgccgcaaatccggttcactgcatttatcgcacaagactctt
gtgatgctactcggaacagatcctaaactggcaccgaaggaatctttgccctgccatcag
ccacaagtcactcgccgagtatccaaagatgattggattgagtggcttaaacgtttgtct
attggccttctgaaggagtctccgtcgcatgcattgcgagcctgctgtaacctggcccag
gattatgacactttgctaagggatttgttcaatgctgccttcatttcctgctggacagaa
ttgtcagctgagcataaaaatgagcttacccaatcgttgatccaagccctgcaggtcacc
gatatgccagagataacccagaccattttgaatctggcggagttcatggagcattgcgac
cgcgatcccataccaattgaaaccaagctattaggaacccgcgccatggcctgcagggcc
tatgccaaggctttgcgatacaaggaagaagagtttcttctacgagaagatcctcaggtt
ttcgagtccttgattttgatcaacaacaaactgcaacagagagaagctgcagaaggtctc
ctaaccacctatcgtaacgccgccaacgagcttaatgtccagggacgttggtacgagaaa
ctacacaactgggatcaggcattggaacactataaatacagcttgggccaagattcgtcc
gacttggaggctcgtctgggccacatgcgctgccttgaggccttgggagattggacagaa
ctaagcaatgtgacgaaacatgaatgggacacctttggttcagaggccagggcgagggcc
agcccgctggctgccgtagctgcttggggtctacaagattgggaggccatgcaggagtat
gtccgttgcataccagtggacacgcaagatggtagctattatcgtgccgttctagccgtg
catcatgatgattacgaaaccgcccagagattaattgatgagacgagagatttgctggac
actgaactgacctccatggctggcgagtcctacgaacgggcctacggagcaatggtatgc
gtccaaatgttggcggaacttgaggaggtcatacaatacaaactgatacccgagagacga
gaacccctaaaggccatgtggtggaaacgtttgcaggggggccaaaggctggtggaagat
tggcgccggattatccaggtgcattcgttggtggtgaagccacacgaggatatacacacc
tggctgaaatatgcctcactttgccgcaaatccggttcactgcatttatcgcacaagact
cttgtgatgctactcggaacagatcctaaactggcaccgaaggaatctttgccctgccat
cagccacaagtaacctatgcctataccaaatatatggctgcatcggatcaattgcctcaa
gcttatgagcaattgcgtcggtttgtcaacacttacaatgcgcaattgccgccggaggct
ctgaatcaacaggatcagcggttgatggccaggtgctatcttcgcctagccacctggcag
aataagttgcaggaaccggtggtgaaggatgccatacaaaaggctctggattactatgaa
aaggccaccacgtatgaccccaattggtacaaagcttggcatttgtgggcctacatgaat
ttcaaggtggttcaagggcagaagcagagcctggataagcagcaacatcaaccacaacct
ctgcaaagcttgggcctgaacttgggattgggtggtggcatggatagtgagcattttatt
atccaacaatacgcagtgccagctgtgcaaggatttttccgctccatcagtctgatcaag
ggcaattctctgcaggatactttacggctgctcactttgtggtttgattatggtcatcat
gccgaggtttacgaggcgttgctctctggcatgaagctgatagagattaatacgtggctc
caggtcatacctcagttgattgcacgcattgatacacacaggaagctcgtgggacaactt
atccatcagcttctgatggatataggaaagaatcatcctcaagctttggtctatccgttg
acggtggcttccaaatcggcatcattggccagaaagaatgctgctttcaagattttggac
tccatgagaaagcattctcccattttggtcgagcaggcggtaatgtgcagcgaggaactt
attagagttgccattctatggaacgagcagtggcataagggattggaggtggcttcgcgt
ctatattttgttgatcagaatataaaagaaatgatcgatgtactggatgaattgcatgcc
atgctggatcgtggtccagaaacacctgaagagatctcatttacgcaaacgtttggagaa
gacctagccgaggcctgtgaatggatacagcaatacaagatttcaggagtgcaaacagat
ctagataatgcctggaatatatacaaatatgtgtactggaatacagaacctaaccagttg
tcgtcatttgaattgtcccatgtgtcgcctaaattgttgagctgcaaggatttggagtta
gccgtaccaggctcatatcatccagggcacgagttaatacgcataaattgtgttagctct
gatcttcaggtaatcaaatctaagcagcgacccaaacgactctccattaaaggctcaaat
ggcaagtattacaggtatttgctaaaggcacacgatgatctccgtctcgatgagcgtgca
atgcagttgttctcattgatcaacacattgctgctgaccaatccggatacctttcgtcat
aatttgaccattcaaagatatgcagtgattccgctaagtacaaattctggtctaattggc
ctggttccacattgtgatacgcttcatcggctgatctccgattatagggaaagaaaagga
gagcaactgaatcaagaactttccactatttacaaatttgcaccagattatgatcgcctc
acagtaatgcaaaaggtcgaagtgtttgaatatactttgagccgtttctctggcaatgat
ttggccaaattgctatggctgaaaagtccctcaacggaacactggttcgagaggcgcaat
aattacactcgttcgctggctgtcatgtccatggtgggatacatcttaggactgggtgat
cggcatccttctaatttaatgttagatcgtatgaatggaaaaattttacatatagatttc
ggtgactgcttcgaggtggccatgttaagagaggcagttccagagaaagttccttttcgt
ctcacccgtatgctgatcaaggccatggaggtcactggcatagagggcacctatcgcaga
acttgtgaaagtgtcatggtggtcctcagacgcaacaaggactctctaatggcagtgctc
gaagctttcgtctatgatcctctgctgaatgatagtctgtttgttgtgaatagaagggtt
cctgagaacaattggtcaaatgccggaggtttcactgaagatggagcaaacactgagaat
agatcaattagtgtggagtctccaatccaacaggaagctgataccaaggctagccaaatt
attaaacgtgtcgatagcaaacttactggcaccgattttgaaaaccaaggaccagtcaat
gagcagcaacaagtagatctccttatacagcaggcaaccaacaatgagaacctctgccag
ggccacattggctggtgtccattctggtaa

DBGET integrated database retrieval system