KEGG   Drosophila willistoni: Dwil_GK15326Help
Entry
Dwil_GK15326      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
Organism
dwi  Drosophila willistoni
SSDB OrthologParalogGFIT
Motif
Pfam: Lys
Motif
Other DBs
NCBI-GeneID: 6642736
NCBI-ProteinID: XP_002065208
FlyBase: FBgn0217331
UniProt: B4MUJ9
Position
Unknown
AA seq 120 aa AA seqDB search
MNSTKLSRLYLLFLLVIATGSHVWAKLYLRCELARKLLNQHGFERSLLSNWICLLEHESE
LNTAKVTTNPNGSKNYGLFQINGRYCQQGRRGGTCNVDCDDLLDENIHEAAICAKRIQIS
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaacaaagcttagtcgactgtatttgctatttctgctagttattgcaacggga
agtcatgtgtgggccaagttgtatctacgctgtgaacttgcccgtaagctgctgaatcag
catggctttgaacgcagtttgctatccaattggatttgtctgctagaacatgaaagtgaa
ttgaacactgcaaaagtgactacaaacccgaatggatcaaagaactatggtctatttcag
atcaatgggcgatattgtcagcagggcagacgtggtggcacatgcaacgtagactgcgat
gatcttctcgatgaaaacattcacgaagcagctatttgtgccaaacgtattcaaatctct
taa

DBGET integrated database retrieval system