KEGG   Drosophila willistoni: Dwil_GK15458Help
Entry
Dwil_GK15458      CDS       T01067                                 

Definition
(RefSeq) GK15458 gene product from transcript GK15458-RB
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dwi  Drosophila willistoni
Pathway
Longevity regulating pathway - multiple species
Wnt signaling pathway
Hedgehog signaling pathway - fly
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dwil_GK15458
   04341 Hedgehog signaling pathway - Fly
    Dwil_GK15458
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dwil_GK15458
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dwil_GK15458
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Dwil_GK15458
Messenger RNA biogenesis [BR:dwi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dwil_GK15458
Chromosome [BR:dwi03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Dwil_GK15458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 353 aa AA seqDB search
MGNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRV
MIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLY
MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQ
GYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWF
ASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggtaataacgcaacaacatccaataagaaagtcgatgccgccgagactgtcaaggag
ttccttgagcaggccaaagaggaattcgaggataaatggcgtcgcaatccgaccaatacc
gctgccctcgatgatttcgaacgcatcaagacactgggcaccgggtcctttggccgtgtc
atgatcgtccagcataagccaacaaaagactattatgccatgaagatactcgataagcag
aaggttgtcaagctgaagcaggtggagcatacgttgaacgagaaacgtattctgcaggcc
atacaatttccatttttggtatcgttacgctatcatttcaaggataactccaatttgtat
atggtcctcgagtatgtgccaggcggtgagatgttctcacatttgcgtaaagtcggtcgc
ttctcggagccccattcccgtttctatgcggcacaaattgtcctggcgtttgagtatttg
cattatttggatttaatctatcgagatttgaagcccgagaatttgctaatcgattcgcag
ggttatctcaaggtcaccgattttggttttgccaaacgtgtcaagggacgcacttggacc
ttgtgcggcaccccagagtatttggcacccgaaattatattatcgaagggctataacaaa
gccgtcgattggtgggccctcggcgtcttggtctatgaaatggcagccggttatccgccc
ttctttgccgatcagcccatacagatctatgagaaaattgtctctggcaaagtacgtttc
ccctcgcattttggttccgatttgaaggatctattgcgtaatctactgcaggtggattta
actaaacgctatggcaatctaaaggcgggcgttaatgatattaaaaatcaaaaatggttc
gcctcaaccgattggattgcgatcttccagaagaaaatcgaagccccgttcataccgagg
tgtaaaggtcccggcgatacaagcaatttcgatgactatgaggaggaggcgctgcgaatt
tccagcactgaaaaatgcgccaaggagtttgctgaattctaa

DBGET integrated database retrieval system