KEGG   Drosophila willistoni: Dwil_GK15458Help
Entry
Dwil_GK15458      CDS       T01067                                 

Definition
GK15458 gene product from transcript GK15458-RA
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dwi  Drosophila willistoni
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dwil_GK15458
   04340 Hedgehog signaling pathway
    Dwil_GK15458
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dwil_GK15458
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Dwil_GK15458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 498 aa AA seqDB search
MNRLNKTKGKKNSRKSKGKRKSPSRKLKKKSHHSSSSTGGQQQLQQQSTSYEGEGEGDEG
GAGGGGGGGLEQQQQQTTTAGAAGTSSGQQQQQQQKKTTADTPLETTASGTSSSSKDHED
QQQQQAQVSATATFRLSSLTGTISKMGNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRR
NPTNTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEK
RILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVL
AFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILS
KGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNL
LQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEE
EALRISSTEKCAKEFAEF
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcttaaacaaaacgaagggcaagaagaattcaagaaaatctaaaggaaagcga
aagagtccgagtcgcaaattaaaaaaaaaatctcatcatagttcttcgtcaaccggagga
caacagcagctgcagcaacagtcgaccagttacgagggcgagggcgagggtgacgaagga
ggtgctggtgggggtggaggaggaggtctggagcagcagcagcagcagacgaccaccgcc
ggagccgctggtaccagttccggccaacaacaacaacagcaacaaaaaaagacaacggca
gatactccattagagacaacagcttctggaacttcctctagttccaaggaccacgaagac
cagcagcagcagcaagctcaagtatcggccacagccacatttcgtttatcctcgctaacc
ggtaccatatcgaaaatgggtaataacgcaacaacatccaataagaaagtcgatgccgcc
gagactgtcaaggagttccttgagcaggccaaagaggaattcgaggataaatggcgtcgc
aatccgaccaataccgctgccctcgatgatttcgaacgcatcaagacactgggcaccggg
tcctttggccgtgtcatgatcgtccagcataagccaacaaaagactattatgccatgaag
atactcgataagcagaaggttgtcaagctgaagcaggtggagcatacgttgaacgagaaa
cgtattctgcaggccatacaatttccatttttggtatcgttacgctatcatttcaaggat
aactccaatttgtatatggtcctcgagtatgtgccaggcggtgagatgttctcacatttg
cgtaaagtcggtcgcttctcggagccccattcccgtttctatgcggcacaaattgtcctg
gcgtttgagtatttgcattatttggatttaatctatcgagatttgaagcccgagaatttg
ctaatcgattcgcagggttatctcaaggtcaccgattttggttttgccaaacgtgtcaag
ggacgcacttggaccttgtgcggcaccccagagtatttggcacccgaaattatattatcg
aagggctataacaaagccgtcgattggtgggccctcggcgtcttggtctatgaaatggca
gccggttatccgcccttctttgccgatcagcccatacagatctatgagaaaattgtctct
ggcaaagtacgtttcccctcgcattttggttccgatttgaaggatctattgcgtaatcta
ctgcaggtggatttaactaaacgctatggcaatctaaaggcgggcgttaatgatattaaa
aatcaaaaatggttcgcctcaaccgattggattgcgatcttccagaagaaaatcgaagcc
ccgttcataccgaggtgtaaaggtcccggcgatacaagcaatttcgatgactatgaggag
gaggcgctgcgaatttccagcactgaaaaatgcgccaaggagtttgctgaattctaa

DBGET integrated database retrieval system