KEGG   Drosophila willistoni: Dwil_GK15473Help
Entry
Dwil_GK15473      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
dwi  Drosophila willistoni
Module
dwi_M00694  cGMP signaling
Brite
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dwil_GK15473
Protein kinases [BR:dwi01001]
 Serine/threonine kinases: AGC group
  PKG family
   Dwil_GK15473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr cNMP_binding PKcGMP_CC Kinase-like APH Seadorna_VP7 Serglycin
Motif
Other DBs
NCBI-GeneID: 6642441
NCBI-ProteinID: XP_002065485
FlyBase: FBgn0217478
UniProt: B4MVC6
Position
Unknown
AA seq 1097 aa AA seqDB search
MRFCFDRLCFATKRPATNRQNQTNEEPQCTSFISEVDAPPPSQRSAPPTAQLPPASTTES
SVSNHFYADYQKLQPAIINNSSSEAKPPDIALQPQSQLSATPSPPIPPTQTAPPPIQPPI
VEAPFQLPLRLYRRHSSAEDQRTLTTATRKSPSETPTLRRAISMQQQEPNANYHQFPSDL
GLINNNAGAGPIVINTSNPNNINNNNPNQLLGTGIVTLPAANLGLLGLEHTSAGLRLVPA
PPPHSDVLTHTLIYGTPPSGTLQQLHTDPRSLLHQQELQLQQRYQQLQQLQAQTQGFYTA
TGSPVLYQHHQQQQHHQQQQQQQQQPTIAQTQPLPIPGSPAACHSPTVPPNTLGLAQQMQ
GLRISSGCTPDTPSPVGMADPSASLTYIAATPQEERFIQIIQAKDLKIQEMQRALQFKDN
EIAELKSHLDKFQSVFPFSRSSAAGCAGSGAGSGASGGGGGGGSSPGPSTGTGATRKSGQ
TFQRQRAQGISAEPQSESSVLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIRE
IVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYN
CQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYTDFLKSVPIFKDLPDDTLIKIS
DVLEETHYERGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKA
LQGDDLRTANIICESPEGVSCLVIDRETFNQLISSLDEIKHRYDDEGALERRKINEEFRD
LNLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMG
EANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDGTTRFYTACVVEAFDY
LHSRNIIYRDLKPENLLLDERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRG
HDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKL
CRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPTVKSVVDTTNFDDYPP
DPEGPPPDDITGWDKDF
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttttgctttgatcggctgtgctttgccacaaagcggccagccacaaatcgccaa
aatcaaaccaatgaggagccacagtgcactagtttcatatcagaagtagatgcaccacca
ccatcacagagatcagcaccacccacagcacaattgccacctgcatcaacaacagaatcg
tcagttagtaatcatttctatgccgactatcagaaattgcaaccggcgataatcaataac
agcagcagcgaggccaagccaccggacatagcactacaaccacaatcacaattgtctgct
acaccttcaccacccataccacccacccagacagcaccaccacccatacaaccacccatc
gtagaagcgccatttcaattgccgttgcgtctctatcgccgtcatagcagcgccgaagat
caacgaacgttgacgacagcgacgagaaaatctccgagcgaaacaccgacgctgcgaaga
gccatcagtatgcagcaacaggagccgaatgccaactatcatcagtttcccagcgacttg
gggctgatcaacaacaacgccggtgctggacccatcgttatcaacacctccaaccccaac
aacatcaacaacaacaatccgaatcagcttctgggcacgggcattgtcacattgcccgct
gccaatttgggtctgttgggactggagcatacctcagcgggtctacgtctagtgccggca
ccaccgccccactctgatgttctaacccacacactaatctatggtacaccaccgagtggt
acgctgcagcagttacacacagatcccaggagtctgctgcatcaacaggaactgcagttg
cagcaacgctatcaacaattgcagcaattgcaggcgcagacacaaggtttctatacggcc
acagggagtccggttctataccagcatcatcaacagcagcagcaccaccagcagcagcag
cagcaacaacagcaaccaacgatagcacaaactcaacctctgcccatacccggatcaccg
gcggcgtgtcattcgcccacagtaccaccaaatacattaggcctggcccagcaaatgcag
ggattgcgtatatcgtcgggctgtaccccggacaccccgtctccggtgggtatggcggat
ccatctgcatccctcacctacatagccgccacgccgcaagaggagcgcttcattcagata
atacaggccaaggatctaaagattcaggaaatgcaacgagcccttcagttcaaagacaat
gaaatcgctgaactcaaatcgcatttggataaatttcaaagtgtcttccccttcagtcga
agtagtgcggcgggatgtgctggcagtggagcaggtagtggtgcttcaggcggcggtgga
ggaggtggatctagtccgggaccaagtacaggcacaggagcaactcggaaatcgggtcaa
acatttcaacgacagcgcgctcagggtatatcagcggaaccgcaaagcgaatcatcggtg
ctattggagcatgtcagttttcccaaatatgataaggatgagcgctcccgtgagcttatc
aaagctgccattttggataacgatttcatgaagaatttggacttgacgcaaattcgtgaa
attgtcgattgcatgtatccagttaaatatccagccaagaatctgattatcaaagaaggg
gatgtcggcagcattgtctatgtgatggaagatggccgcgttgaggtgtcacgcgaaggc
aaatatctctcaaccctttcgggagccaaagttttgggtgaattggccattttatataat
tgccagaggacagcaacaatcacggccataactgagtgcaatctttgggccattgagcga
caatgtttccaaacaataatgatgcgaactggcctgatcaggcaggccgagtacacggac
ttcctcaagagtgtaccaattttcaaagacttgcccgatgatacactgatcaaaatctcg
gatgtccttgaggagactcactatgaacgcggtgattatattgtacggcaaggagcacgc
ggtgataccttcttcatcatatccaagggtaaagtgcgtgtgaccattaagcagcaggat
acacaggaggagaaattcatacgtatgctgggcaaaggagatttctttggtgaaaaagct
ttgcaaggggatgatctacgcacggcgaatattatatgcgaatcacctgaaggtgtcagc
tgtttggtcattgatcgtgagacatttaatcagctgatttcaagtttagatgaaatcaaa
catcgctacgatgatgaaggagctctcgagcgtagaaaaatcaatgaggaattccgtgat
ttaaatctcaccgatctacgtgtcattgccacattgggagtcggtggtttcggacgcgtt
gaattggtccaaacgaatggcgatagctcacgttcctttgccctgaaacagatgaagaag
tcgcaaattgtcgagacccgacaacagcagcacataatgtccgaaaaggagataatgggc
gaggcaaattgtcagtttatagtgaaactattcaagacctttaaggacaagaaatatctc
tatatgctcatggagagttgtctgggcggtgaactgtggacgatattgcgtgacaagggc
aacttcgatgatggcaccactcgattctatacagcttgtgtggtggaggcctttgattat
ctgcactcgcgcaatatcatctatagggatttgaagccagagaatttactactcgacgag
cggggctatgtcaaattggttgactttggttttgccaagaaattgcaaacgggtcgcaag
acttggacattctgtggcacacccgaatatgtggccccggaagtgatattgaatcgcggc
catgacattagtgcggattattggtcgttgggtgtcttgatgtttgagttgttgacggga
accccaccattcactggctctgatcccatgcgtacctataatattatacttaagggcatt
gatgccatcgaatttccacgcaatatcacacgcaatgccagcaatttgattaagaaattg
tgtcgtgataatccagctgaacgtttgggctatcaacgtggtgggattagtgaaatacaa
aagcataaatggttcgatggcttctattggtggggcctgcagaattgtactctagaaccg
cccataaagccaacagtcaagagtgtggttgatacaacaaactttgatgattatccaccc
gatccagaaggaccaccgccagatgatatcaccggatgggataaagatttctag

DBGET integrated database retrieval system