KEGG   Drosophila willistoni: Dwil_GK15473Help
Entry
Dwil_GK15473      CDS       T01067                                 

Definition
GK15473 gene product from transcript GK15473-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dwil_GK15473
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dwil_GK15473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1097 aa AA seqDB search
MRFCFDRLCFATKRPATNRQNQTNEEPQCTSFISEVDAPPPSQRSAPPTAQLPPASTTES
SVSNHFYADYQKLQPAIINNSSSEAKPPDIALQPQSQLSATPSPPIPPTQTAPPPIQPPI
VEAPFQLPLRLYRRHSSAEDQRTLTTATRKSPSETPTLRRAISMQQQEPNANYHQFPSDL
GLINNNAGAGPIVINTSNPNNINNNNPNQLLGTGIVTLPAANLGLLGLEHTSAGLRLVPA
PPPHSDVLTHTLIYGTPPSGTLQQLHTDPRSLLHQQELQLQQRYQQLQQLQAQTQGFYTA
TGSPVLYQHHQQQQHHQQQQQQQQQPTIAQTQPLPIPGSPAACHSPTVPPNTLGLAQQMQ
GLRISSGCTPDTPSPVGMADPSASLTYIAATPQEERFIQIIQAKDLKIQEMQRALQFKDN
EIAELKSHLDKFQSVFPFSRSSAAGCAGSGAGSGASGGGGGGGSSPGPSTGTGATRKSGQ
TFQRQRAQGISAEPQSESSVLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIRE
IVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYN
CQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYTDFLKSVPIFKDLPDDTLIKIS
DVLEETHYERGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKA
LQGDDLRTANIICESPEGVSCLVIDRETFNQLISSLDEIKHRYDDEGALERRKINEEFRD
LNLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMG
EANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDGTTRFYTACVVEAFDY
LHSRNIIYRDLKPENLLLDERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRG
HDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKL
CRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPTVKSVVDTTNFDDYPP
DPEGPPPDDITGWDKDF
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttttgctttgatcggctgtgctttgccacaaagcggccagccacaaatcgccaa
aatcaaaccaatgaggagccacagtgcactagtttcatatcagaagtagatgcaccacca
ccatcacagagatcagcaccacccacagcacaattgccacctgcatcaacaacagaatcg
tcagttagtaatcatttctatgccgactatcagaaattgcaaccggcgataatcaataac
agcagcagcgaggccaagccaccggacatagcactacaaccacaatcacaattgtctgct
acaccttcaccacccataccacccacccagacagcaccaccacccatacaaccacccatc
gtagaagcgccatttcaattgccgttgcgtctctatcgccgtcatagcagcgccgaagat
caacgaacgttgacgacagcgacgagaaaatctccgagcgaaacaccgacgctgcgaaga
gccatcagtatgcagcaacaggagccgaatgccaactatcatcagtttcccagcgacttg
gggctgatcaacaacaacgccggtgctggacccatcgttatcaacacctccaaccccaac
aacatcaacaacaacaatccgaatcagcttctgggcacgggcattgtcacattgcccgct
gccaatttgggtctgttgggactggagcatacctcagcgggtctacgtctagtgccggca
ccaccgccccactctgatgttctaacccacacactaatctatggtacaccaccgagtggt
acgctgcagcagttacacacagatcccaggagtctgctgcatcaacaggaactgcagttg
cagcaacgctatcaacaattgcagcaattgcaggcgcagacacaaggtttctatacggcc
acagggagtccggttctataccagcatcatcaacagcagcagcaccaccagcagcagcag
cagcaacaacagcaaccaacgatagcacaaactcaacctctgcccatacccggatcaccg
gcggcgtgtcattcgcccacagtaccaccaaatacattaggcctggcccagcaaatgcag
ggattgcgtatatcgtcgggctgtaccccggacaccccgtctccggtgggtatggcggat
ccatctgcatccctcacctacatagccgccacgccgcaagaggagcgcttcattcagata
atacaggccaaggatctaaagattcaggaaatgcaacgagcccttcagttcaaagacaat
gaaatcgctgaactcaaatcgcatttggataaatttcaaagtgtcttccccttcagtcga
agtagtgcggcgggatgtgctggcagtggagcaggtagtggtgcttcaggcggcggtgga
ggaggtggatctagtccgggaccaagtacaggcacaggagcaactcggaaatcgggtcaa
acatttcaacgacagcgcgctcagggtatatcagcggaaccgcaaagcgaatcatcggtg
ctattggagcatgtcagttttcccaaatatgataaggatgagcgctcccgtgagcttatc
aaagctgccattttggataacgatttcatgaagaatttggacttgacgcaaattcgtgaa
attgtcgattgcatgtatccagttaaatatccagccaagaatctgattatcaaagaaggg
gatgtcggcagcattgtctatgtgatggaagatggccgcgttgaggtgtcacgcgaaggc
aaatatctctcaaccctttcgggagccaaagttttgggtgaattggccattttatataat
tgccagaggacagcaacaatcacggccataactgagtgcaatctttgggccattgagcga
caatgtttccaaacaataatgatgcgaactggcctgatcaggcaggccgagtacacggac
ttcctcaagagtgtaccaattttcaaagacttgcccgatgatacactgatcaaaatctcg
gatgtccttgaggagactcactatgaacgcggtgattatattgtacggcaaggagcacgc
ggtgataccttcttcatcatatccaagggtaaagtgcgtgtgaccattaagcagcaggat
acacaggaggagaaattcatacgtatgctgggcaaaggagatttctttggtgaaaaagct
ttgcaaggggatgatctacgcacggcgaatattatatgcgaatcacctgaaggtgtcagc
tgtttggtcattgatcgtgagacatttaatcagctgatttcaagtttagatgaaatcaaa
catcgctacgatgatgaaggagctctcgagcgtagaaaaatcaatgaggaattccgtgat
ttaaatctcaccgatctacgtgtcattgccacattgggagtcggtggtttcggacgcgtt
gaattggtccaaacgaatggcgatagctcacgttcctttgccctgaaacagatgaagaag
tcgcaaattgtcgagacccgacaacagcagcacataatgtccgaaaaggagataatgggc
gaggcaaattgtcagtttatagtgaaactattcaagacctttaaggacaagaaatatctc
tatatgctcatggagagttgtctgggcggtgaactgtggacgatattgcgtgacaagggc
aacttcgatgatggcaccactcgattctatacagcttgtgtggtggaggcctttgattat
ctgcactcgcgcaatatcatctatagggatttgaagccagagaatttactactcgacgag
cggggctatgtcaaattggttgactttggttttgccaagaaattgcaaacgggtcgcaag
acttggacattctgtggcacacccgaatatgtggccccggaagtgatattgaatcgcggc
catgacattagtgcggattattggtcgttgggtgtcttgatgtttgagttgttgacggga
accccaccattcactggctctgatcccatgcgtacctataatattatacttaagggcatt
gatgccatcgaatttccacgcaatatcacacgcaatgccagcaatttgattaagaaattg
tgtcgtgataatccagctgaacgtttgggctatcaacgtggtgggattagtgaaatacaa
aagcataaatggttcgatggcttctattggtggggcctgcagaattgtactctagaaccg
cccataaagccaacagtcaagagtgtggttgatacaacaaactttgatgattatccaccc
gatccagaaggaccaccgccagatgatatcaccggatgggataaagatttctag

DBGET integrated database retrieval system