KEGG   Drosophila willistoni: Dwil_GK15547Help
Entry
Dwil_GK15547      CDS       T01067                                 

Definition
GK15547 gene product from transcript GK15547-RA
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dwil_GK15547
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     Dwil_GK15547
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     Dwil_GK15547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 656 aa AA seqDB search
MSGNESNLTNVEAATAAIAMEPSDPISIMPSPSSKRLTSIDHTVPASPTLQSPSVRRNKS
DGNLMAQDVKEARVKVIYTGGTIGMMRNDRHVLTPIPNALVRSIRKYPNIHDDEYAQLRF
GASASMAPLVLPYVQDEPRRVLYQITEYTPLLDSSNMTMNDWARIANDIHQSYEFFDGFV
VLHGTDTLSYTASALSFMLENLGKTVIITGSQIPIFETRTDGKDNFTSALIIAGNYIIPE
VCIFFGHKLMRGNRTVKISSNSLDAFDSPNVPPLARIGINVNVDYRLIFRPCSIERFCVH
LNLDENVGVLRLFPSISLSTFRAFLAPPMRGVVLQSFGSGNIPSNRKDLMDALKAAADRG
VIIINCTQCPNGSVAAIYDTGKVLSDVGVIPGYDMTPEAALAKLAYVIGKEEWSLEVKKQ
MMQSNLRGELTSIIAPKMEDYDLVDAVARSLHLSSPQELDQLGATLFPAMINAAVVDGDL
KKINNLKAYGADLSGSNHDHRTALHLACQLGNVEIVKHLLRNGVSVHTRDRYERTALLEA
VSTDNHEIIQLLINCGAHLTGSSRAVGEQLCAAAARGSLLRLKSYQYAGADLSQPDPSGR
TVLHLAALHGFPEVIQYVLPYMENVAAEDMLGLNALHYAKRGGDPAVVDLLKSVIS
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaaacgaatctaatctcacgaatgtggaagctgccacagcagccatagccatg
gaacccagtgaccccatcagcattatgccatctccatccagtaaaaggctaacatcaatt
gatcatacggtgccagcatccccgacactgcaaagtcctagtgtgcgacgtaataagagc
gatggcaatctaatggctcaagatgtgaaggaagcacgtgttaaagtcatctataccggt
ggcaccattggcatgatgcggaacgatcgacacgtccttacacccattccaaatgctttg
gtccgcagcatacggaaatatccaaacatacatgatgacgaatatgcgcaattgcgtttt
ggggcttcagcatcgatggctcccttggtccttccttatgtacaagacgaaccaaggcgt
gtgctctatcagattacggaatatactccgctgctggacagcagtaatatgacgatgaac
gattgggcccgcatagccaatgatatacatcaatcttatgagttctttgatggtttcgtc
gtgttacacggcaccgatacactctcctataccgcgtccgcgttgtcgttcatgcttgaa
aaccttgggaaaacggtcattatcacaggatcacagatacccatctttgagacgcgcact
gatggcaaggataactttacgtcggctttgattatagcaggaaactatatcataccagag
gtatgcatttttttcggccacaaactgatgcgtggcaatcggacggtgaaaattagttcc
aattcgctagatgccttcgattcaccaaatgtgccaccgctggctcggatcggaatcaat
gtgaatgttgattatcgtctcatcttccggccatgtagcattgaacgtttttgtgtccac
ctgaatctggacgagaatgtgggcgtattgcgattatttccaagtatttcattgtccact
ttccgggcatttttggccccacccatgaggggtgtggtattgcaatcgtttggctcggga
aatataccatctaaccgaaaggaccttatggatgcacttaaagcggccgccgatcgcggt
gtgatcataatcaattgcactcagtgtccaaacggctcagtggcagccatatacgatacg
ggcaaagtgctcagcgacgtgggtgtgatacctggctatgatatgacgcccgaagcggct
ctcgccaagctggcctacgttattggcaaggaggaatggtccttggaggttaaaaagcag
atgatgcaatcgaacctccgcggcgaattaacatcgattattgcccccaaaatggaagat
tatgacctggtggatgctgttgcccgttcgctgcatctctcgtccccgcaggagctggat
cagttgggcgcaacgctctttccggcaatgatcaatgctgctgtagttgatggggatttg
aaaaagatcaacaacctaaaggcatacggcgcagatctatccggatcgaatcatgatcat
cgcactgcccttcatttagcctgtcagctggggaatgtagagattgtaaagcatttgttg
cgcaatggtgtatctgtgcacacacgcgaccgctatgagcgcacagccctcctggaggcc
gtgtccacggataaccatgagatcatccagttgctaatcaattgtggagcccatttgacg
ggctcatctcgtgctgttggcgaacagctttgtgcggcagctgcccgcggttcattgctt
cgcctgaaatcgtatcagtatgcgggtgctgatctatcacaaccggatccatctggacgc
actgttttgcatctggctgcacttcatggttttcccgaagtgattcaatatgtcctgccg
tacatggaaaacgttgcagctgaggatatgctgggacttaatgctctacactatgctaaa
cgtggtggtgatccagctgtagtggatctacttaaatcggttatttcctaa

DBGET integrated database retrieval system