KEGG   Drosophila willistoni: Dwil_GK15553Help
Entry
Dwil_GK15553      CDS       T01067                                 

Definition
GK15553 gene product from transcript GK15553-RA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dwi  Drosophila willistoni
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dwil_GK15553
   00053 Ascorbate and aldarate metabolism
    Dwil_GK15553
   00500 Starch and sucrose metabolism
    Dwil_GK15553
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dwil_GK15553
   00860 Porphyrin and chlorophyll metabolism
    Dwil_GK15553
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dwil_GK15553
   00982 Drug metabolism - cytochrome P450
    Dwil_GK15553
   00983 Drug metabolism - other enzymes
    Dwil_GK15553
Enzymes [BR:dwi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dwil_GK15553
Glycosyltransferases [BR:dwi01003]
 Others
  Hydrophobic molecule
   Dwil_GK15553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 525 aa AA seqDB search
MQLHWICIFVLFLPGLGAGYRILFMGPFPAPSHWMWLEHFQRDLLKRGHQVTSVNNHPTK
KPHENLTEIILSPSFDIPKHFPKKNIFSMRFASDFQNLQMWWQIGLMTTEHALQDPKLKQ
LIASKDEHFDLVILEQFFHEAFLMFGKKFNCPVVTIGTMGYADNMDHAMGILTPWSVIPH
LLLSHTDQMTFSQRAYNTYLSMYDAVMRRWYYLPKMQELAEKHFNNYIEGPLPHVHQLER
NISLMLINSHRSVDLPRPSMPGLINVGGAHIQPAKKLPEELQSFLDKATHGVVYFSLGSY
MKSTDMPPEKTALILKAFGQLKQQVLWKYENESIGQLPSNVMIKQWMPQNDILAHPNIKL
FITHGGIFGTQEGIYWGVPMLCIPLYGDQHRNSIKSVREGYARSLIFSKLTTDDLVRNIE
AMIYEPQYKRSALEVSQRFRDNPIHPMDEASYWIEYIIRHGGAKHLKSHGAFLPLYQYLL
LDVLFCVLLAAWLTIWLPWRMLRRVYRWWAAGNEAAKVDKEKKLL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgcactggatatgcatatttgtgctcttcctgcccggattgggtgcgggttat
cgtatactcttcatgggaccctttccggcgcccagtcattggatgtggctggagcacttt
cagcgtgatctactcaaacgtggccatcaggtgaccagcgtgaacaatcatcctacaaaa
aagccacacgagaatctaacagagatcatactaagcccctcatttgatatacccaaacat
tttcccaaaaagaacatttttagcatgagatttgccagcgactttcagaatcttcaaatg
tggtggcaaataggattaatgacgacggagcacgcacttcaggatccaaaactaaagcaa
ttgattgcatctaaagatgagcattttgatctggtgattttggaacaattcttccatgaa
gcttttttaatgtttggcaaaaaattcaattgtccagtcgttaccataggcacaatggga
tatgccgataatatggaccatgccatgggcattttgactccttggtctgttattccacat
ctcctgctatcccatacggatcagatgacattcagccagcgtgcttataatacatatctc
tcaatgtacgacgccgtaatgcgtcgttggtattatctacccaaaatgcaggagttggca
gaaaagcatttcaataattacatagaaggaccgctgcctcatgtccaccaactggagaga
aatatctctttgatgctaatcaatagtcatcgtagtgtggacctgccccgacccagcatg
ccgggtctaatcaacgtgggtggtgctcacatacaaccagctaagaaactgccagaggag
ttgcaatccttcctcgacaaggccactcatggcgtagtctacttcagcctgggttcctat
atgaagagcacggatatgccgccggagaagacagccctcatattgaaggcctttggccaa
ctgaagcagcaagttttgtggaaatacgaaaatgaatcaattggccagttaccctcgaat
gtgatgattaagcaatggatgccccagaatgatattctagcccatccgaatattaagcta
ttcatcacccatggaggcatcttcggcacccaggagggcatctattggggtgtgccaatg
ctgtgcatccccctctatggagatcagcataggaattcgatcaagtcggttcgtgagggt
tatgctcgatccctgatcttttccaaactcaccacagatgatttagttcgcaacatagag
gccatgatatacgagcctcaatacaagcggagtgccttggaggtgtcgcaacgtttccgc
gataatcccatacatccgatggatgaggctagctactggattgaatacatcataagacat
ggcggtgcgaaacatttgaaatcgcatggggccttcttgccattgtatcagtatttgctg
ttggacgtattattctgcgtgcttttggccgcatggctaaccatttggctgccctggcgt
atgttgaggcgtgtctatagatggtgggcagcggggaatgaagctgcaaaggtggataag
gaaaagaaacttttataa

DBGET integrated database retrieval system