KEGG   Drosophila willistoni: Dwil_GK15712Help
Entry
Dwil_GK15712      CDS       T01067                                 

Definition
GK15712 gene product from transcript GK15712-RA
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dwi  Drosophila willistoni
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dwil_GK15712
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dwil_GK15712
   04070 Phosphatidylinositol signaling system
    Dwil_GK15712
 Organismal Systems
  Sensory system
   04745 Phototransduction - fly
    Dwil_GK15712
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Dwil_GK15712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1095 aa AA seqDB search
MTKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGR
DGDVIELCQVSDIRAGGTPRDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHV
ICPDAATAKSWQKNLRLITHNNKATNVCPRLNLMKHWMRLSYCVEKSGKIPVKTLAKTFA
SGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFEKFYALYHKVCPRNDIEELFTSITKGKQ
DFISLEQFIQFMNDKQRDPRMNEILFPLYEEKRCTEIINDYELDEEKKKNVQLSLDGFKR
YLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGC
RCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNR
AQQYKLAKYCDDFFGDLLLKEPLPDHVLEPGLPLPPPCKLKRKILIKNKRMKPEVEKVEL
ELWLKGELKTDDDPEEDASAGKPPEAAAAPAPAAPEAAAADAAAEGGGGAEAEAAAANYS
GSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYN
KRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQTSDLPMQLNQGKFEYNGGCGYLL
KPDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVK
KEFRTRLVPNNGLNPVYNEDPFVFRKVVLPDLAVLRFGVYEESGKMIGQRILPLDGLQAG
YRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKAL
GIEEQSGGAARDAGKAKEEEKKEPPLVFEPVTLESLRQEKGFQKVGKKQIKELDTLRKKH
AKERTSVQKTQNAAIDKLIKGKSKDDIRNDANIKNAINDQTKQWTDMIARHRKEEWDMLR
QHVQDSQDAMKALMLTVQAAQIKQLEDRHARDLKDLNTKQAKTSADTAKEVQNDKTLKTK
NEKDRRLREKRQNNVKRFMEEKKQIGVKQGRAMEKLKLAHAKQVEEFSTDVQKLMDMYKI
EEEAYKTQGKTEFYA
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaatacgaattcgattggatcattccggtgccaccggaattgaccactggc
tgtgtgttcgatcgctggttcgagaatgagaaggaaaccaaagagaatgactttgaacgt
gatgccctcttcaaggtggatgaatatggattctttctttattggaagagtgagggaagg
gatggcgatgtcattgagctgtgtcaagtgagcgacattcgtgctggcggcacaccaagg
gatcccaaaatactggataaggttacaaaaaagaatggcacgaatataccagaattggat
aaacgttcattgaccatatgctcgaatacggattatatcaatataacatatcatcatgtt
atttgtccagatgcggctacggctaagagttggcaaaagaatttgcgtctcatcactcat
aacaataaagccaccaatgtctgtccacgtctgaatctaatgaaacattggatgcgttta
agctattgcgtggagaagagtggtaaaattccagttaaaactttggctaaaacatttgcc
tcgggcaagacggaaaagctggtctatacatgcatcaaagatgccggtttgccagatgat
aagaatgccaccatgacaaaggagcaattcacattcgagaaattctatgctttatatcac
aaagtctgtccacgtaatgacatcgaggagctattcacatccataaccaagggcaaacag
gatttcattagtctagagcaatttattcaattcatgaatgacaagcaacgtgatcccaga
atgaatgaaattctatttccactctatgaggagaaacgatgcacggagattatcaacgat
tatgaactagatgaggagaagaagaagaatgttcaactctctttggatggctttaagcga
tatctaatgtccgatgagaacgctcccgtgtttctggatcgcctggacttctatatggaa
atggatcaaccattggcccattactatataaatagttcgcataatacttatctatcgggt
cgccaaatcggaggtaaaagctcggtggaaatgtatcgccagaccctgttggccggctgc
cgttgtgtggagcttgattgttggaatggcaagggcgaggatgaggagccaattgttact
cacggccatgcctactgtacagaaattctcttcaaggactgcattcaagccatagcggat
tgcgcttttgtttcatcggaatatcccgtgattttgtcctttgagaatcattgcaatcgt
gcccagcaatataaactagctaaatactgtgatgacttctttggtgatctattgctgaag
gaaccattgccagatcatgtgctggagccgggcttgcccctgccaccgccgtgcaagctg
aagcgcaagattctcattaagaacaagcgcatgaagcccgaagtggagaaggtcgaactg
gagctatggcttaagggtgaattgaagaccgatgacgatccggaagaggacgccagtgcc
ggcaagccgccagaagcagctgctgccccagcgccagcagcacccgaagccgctgctgcc
gatgctgccgctgaaggtggcggcggcgccgaagcggaggcagctgcagccaattacagt
ggttccaccaccaatgtacatccctggctctcatcgatggtcaattatgctcagcccatt
aaattccagggcttcgacaaggcaattgagaagaacattgcccataatatgtcatcgttt
gcggaatcggctggcatgaattacctgaaacagagctcaattgattttgtcaattataat
aagcgtcagatgtctcgcatctatccgaagggcacgcgagccgattcgtccaactatatg
ccacaggtattctggaatgccggctgtcagatggtctcactgaatttccaaacctccgat
ctgcccatgcaactgaaccagggtaaatttgaatataatggcggctgtggctacttgcta
aagccggactttatgcggcgtgccgataaggacttcgatccgtttgccgatgcccccgtg
gacggtgtgattgctgctcaatgttcggttaaagtgattgccggtcaatttttgtcggac
aagaaggttggcacctatgtggaggtggatatgtttggcttgccctccgatacggttaaa
aaggagtttcgtacacgtctggtccccaacaatggactgaatcctgtttacaacgaggat
ccatttgttttccgcaaagttgttctaccagatttggcagtgctgcgcttcggcgtctat
gaggagagcggcaagatgatcggccagcgtattctaccgctggatggtctccaggctggc
tatcggcatgtctcgctgcgcacggaggccaacttcccaatgtcgctgcccatgctgttt
gtgaacatcgaattaaagatttatgtacctgatggctttgaggatttcatggccatgctg
tcagatccacgcggttttgccggtgcggccaagcagcagaacgaacagatgaaggctctt
ggaattgaggagcaaagcggcggtgccgctcgtgatgccggcaaggccaaggaggaggag
aaaaaagagccgccattggtctttgagccagtgacgctggaatctttgcgtcaagagaag
ggcttccagaaggtcggcaagaagcagatcaaggagctcgacaccctacgcaaaaagcat
gccaaggagcgcacctcagtgcaaaagacccaaaatgccgccatcgataagctaattaag
ggcaagagcaaagatgacatacgcaacgatgccaacatcaagaatgccatcaatgatcag
accaaacagtggaccgacatgattgcacgccaccgcaaagaggaatgggatatgctgcga
cagcatgtccaggactctcaggatgccatgaaggctcttatgctaacagtgcaagcagcc
caaatcaagcagctagaagatcgtcatgccagagatctaaaagatttaaataccaagcag
gccaaaacatctgcagataccgccaaggaggtgcagaatgacaagacgctaaagaccaaa
aatgaaaaggatcgtcgtttgcgtgagaaacgtcagaataatgtcaagcgtttcatggag
gagaaaaagcaaatcggcgttaaacagggacgcgccatggagaaattaaaattggctcat
gccaaacaagtggaggagtttagtaccgatgtgcaaaagcttatggatatgtacaaaatc
gaggaggaggcctacaagacccaaggaaaaactgagttttatgcctaa

DBGET integrated database retrieval system