KEGG   Drosophila willistoni: Dwil_GK15747Help
Entry
Dwil_GK15747      CDS       T01067                                 

Definition
GK15747 gene product from transcript GK15747-RA
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     Dwil_GK15747
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   Dwil_GK15747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 422 aa AA seqDB search
MRLFPVRLAAASSSMSSLAKMLDFYSGFNPSPLSIKQFMDFGQNACEKKSYIFLRKELPV
RLANIMKEIALLPDNLLHTRSVSEVSSWYVKSFEDVLEYEKAEPTLDNLQKFVSDLDLIR
NRHNDVVQTMAQGVIEMKENEGGQVDAPTESSIQYFLDRLYMSRISIRMLINQHTLLFGS
NPHSGGRHIGCLDPACDLSDVVRDAYENARFLCDQYYLNSPALEIQQHSCEANDIMPIRT
VYVPSHLYHMLFELFKNSMRAVVEHNHDNCNDNLPPLKVTICRGKEDICVKISDQGGGIP
RSQSDQLFKYMYSTAPQPSKSDLHTVPLAGYGYGLPISRLYARYFHGDIVLMSCEGYGTD
AIIYLKALSDEANELLPIFNKTSSKFYRATVPTGDWSNQSSDMNARQLSATIPKRYNDLG
VE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctctttcccgtccgcctggcggccgcatcgtcctcgatgtccagtttggccaaa
atgttggatttctattctggattcaatccgtcgccgctttcaatcaaacaatttatggat
tttggtcaaaatgcttgcgaaaagaaatcatatatatttctacgtaaagaattgcccgta
cgtctggcaaatataatgaaagagattgcacttttacccgataatttgctgcacacaaga
tcagtcagtgaggtcagttcgtggtatgtgaaaagtttcgaggatgttcttgaatacgag
aaggccgaacctacgcttgacaatctacaaaaatttgtaagcgatttggatctcattaga
aatcgccacaatgatgtggtgcaaacgatggctcagggtgtgattgaaatgaaggagaat
gaaggcggccaggttgatgcaccaaccgagagttccatacaatattttcttgatcgtcta
tatatgtcacgcattagcatacgaatgctaattaatcaacatactcttctctttggttca
aatccacattctggtggcaggcatattggttgccttgatcctgcctgcgatctgtcggat
gttgtgcgtgatgcctatgagaatgcacgttttctctgtgatcaatattatctaaacagt
ccggcattggagatacaacagcatagctgtgaggcgaatgacattatgcccatacggacg
gtatatgtgccttcccatttatatcatatgctctttgagttattcaagaattcgatgcgt
gccgttgtcgagcataatcatgacaattgcaatgataatttgccaccactcaaggtcaca
atttgtcgtggcaaagaggatatatgtgttaagatctccgatcaaggtggcggcattcca
cgctctcaatccgatcagttattcaaatatatgtatagtacagcaccgcagccatcgaaa
tcggatttgcatacagtgccattggctggttatggttatggtttacccatatcgaggcta
tatgcaagatattttcatggtgatattgttttaatgtcctgtgaaggatatggcaccgat
gctattatctatttgaaggctttgtccgatgaggctaatgaattgttgcccattttcaat
aaaactagctcaaagttctatagggccactgtgcccactggtgattggtccaatcagagc
tccgatatgaatgcacgccaattgtcggccaccataccaaaacgttacaatgatttgggt
gtggaatag

DBGET integrated database retrieval system