KEGG   Drosophila willistoni: Dwil_GK16200Help
Entry
Dwil_GK16200      CDS       T01067                                 

Definition
GK16200 gene product from transcript GK16200-RA
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
dwi  Drosophila willistoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 370 aa AA seqDB search
MDTSETPRRQLRNSHLENVQNLSTPIRIPPSPMLKTLGMGTGVSVYRLDRSPRLGQIRSP
WAVKKILKNTLAKKDKLFDERIVYEADILRKLKHPNIVGYRGIVKSTDGTNNLALEMCTT
SLGSILEERHDEHLGPLPARHTFKMIMDIAHALDFLHTEAKLLHGDLKSFNVLVKGEFEI
CKLCDFGVSLPLDDKGEINFQKNPQLNYVGTGLWSPPEIVDEAEIIDSKADIFSFGLVIY
ETLALVPPHFGTVAELADETEIDDDEVSKENIEQDPTMDDDDVAATADDEEDTELDDTKE
NDDEFSLADLESAYGTRPPLPVAFQLSDDYNCIVELFYLCTNALSEDRPSARTIWQCCEN
NAANITTSLE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggatacaagcgaaacgccgcggcgccagctgcgcaattcccatttggagaacgtacag
aatttgagtacacccatacgcataccgccatcaccaatgctaaaaaccctcggcatggga
acaggagtaagtgtctatcgcctggatcgttcaccgcgattgggacaaatccgttcgcca
tgggctgttaagaaaatattaaagaatacgctggccaaaaaggataaattgttcgatgag
cgtattgtctatgaggctgatatattgcgcaaactgaagcatcccaatattgtgggctat
cggggcatagtcaaatccactgatggtacgaataacttggccctggagatgtgcacaaca
tcgttgggctccatactggaagagcgtcatgatgagcatcttggaccattgccagcgagg
catacctttaaaatgatcatggacattgcccatgccctggactttttgcacacggaggcc
aaattgctgcatggagatctcaagtcctttaatgtcctggtcaagggtgaattcgagata
tgcaaattgtgtgatttcggtgttagtctgcctctggatgacaagggtgagattaatttt
caaaagaatcctcaactcaactatgttggtacgggtctctggtcaccaccagaaatcgtt
gatgaagccgagatcattgacagcaaggcggatatctttagttttggattagttatctac
gaaacgttggctctggtgccaccacattttggaactgttgccgaacttgcagatgaaact
gaaatcgatgacgatgaagtttcaaaagagaatatcgaacaggatccaacaatggacgac
gacgacgtcgccgccaccgccgacgacgaagaagacaccgaattggatgacacaaaggag
aatgatgatgaattctctcttgctgatctggaaagtgcctatggcactcgaccaccattg
cctgtggcttttcagctcagcgatgattacaattgtattgttgaattgttttatctgtgc
accaatgctctcagtgaggatcgtccatcggctcgtaccatttggcaatgctgtgagaat
aatgctgccaatataaccacatcgcttgaatag

DBGET integrated database retrieval system