KEGG   Drosophila willistoni: Dwil_GK16217Help
Entry
Dwil_GK16217      CDS       T01067                                 

Definition
GK16217 gene product from transcript GK16217-RA
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
dwi  Drosophila willistoni
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dwi00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1481 aa AA seqDB search
MDVLELLRASANGCYNTIFSDAWSQYVSQQITSSLYLYIALGILTVLFVAWFIYFKRLAR
LRLRDEIARSLNAVTSASGGDLRGLRFRKRDKMLFYGRRMLRKMKNVSGQMYSSGKGYKR
RAVMRFARRILQLRRENMPLEMRTVEPPAEYLEETIEGSDRVPPDALYMLQSIRIFGHFE
KPVFLKLCKHTQVLELMAGDYLFKITDADDSVYIVQSGMINVYISNADGSTLSLKTVRKG
ESVTSLLSFIDVLSGNPSYYKTVTAKAMEKSVVIRLPMQAFEEVFRENPDVMIRVIQVIM
IRLQRVLFTALRNYLGLNAELVQNHMRNKSITISGHLNSQSQSSQSMRQQTTATATGGTS
ATALGGQQLPAAVPSLPLQRQPPPPTIAPPLRHSREEHTLSGPNPNPNSGNNVQLPEVHG
DAPNIDIYHQQQHGGSTSTGNLSTRRGSLVQPSIGGGGGGSTAQEGGCAAAGAPTIDMRL
IQSSAVESLRKELGLPNEDAHIIEPFVEVRELEPNVTLITEGNADDVCIWFVMTGTLAVY
QGVADATRSSTATTKSDKSDLLIHFVHPGEIVGGLAMLTGEASAYTIRSRNNSRVAYIRR
AAIYQIMRQRPRIVLDLGNGVVRRLSPLVRQCDYALDWIFLESGRAVYRQDESSDSTYIV
LSGRMRSVITNPGGKKEIVGEYGKGDLVGIVEMITETSRTTTVMAVRDSELAKLPEGLFN
AIKLRYPIVVTKLISFLSHRFLGSMQTRGSTGAPGAPVEANPVTHKYSTVALVPITDEVP
LTPFTYELYHSLCAIGPVLRLTSEVVRKQLGQNIFEAANEYRLTSWLAQQEDRNIITLYQ
CDNSLSPWTHRCMRQADVILIVGLGDRSHLVGKFEREIDRLAMRTQKELVLLYPETTNAK
PANTLSWLNARPWVTKHHHVLCVKRIFTRKSQYRINDLYSRVLLSEPNMHSDFSRLARWL
TGNSIGLVLGGGGARGAAHIGMLKAIQEAGIPIDMVGGVSIGALMGALWCSERNITTVTQ
KARQWSKKMTKWFLQLLDLTYPITSMFSGREFNKTIHDTFGDVSIEDLWIPYFTLTTDIT
ASCHRIHTNGSLWRYVRSSMSLSGYMPPLCDPKDGHLLLDGGYVNNLPGHLWRYCRASMS
IAGVFPPFCDYRDGHLLLDGCYTNNVPADVMHNLGAAHIIAIDVGSQDDTDLTNYGDDLS
GWWLLYKKWNPFTSPVKVPDLPDIQSRLAYVSCVRQLEEVKNSDYCEYIRPPIDKYKTLA
FGSFDEIRDVGYVFGKNYFESMAKAGRLGRFNQWFNKEPPKRGNHASLNEYTFIDLAQIV
CKLPETYAVNTAEIFSEDEDCDGYISEPSTLNTDRRIQVPRAGNSLSLSEAEMDSDVEID
FRSDSKKDKATQSTPPAPGKDNEDKTDAVDRIPLLTLERPLTDQQQQHSDETDEQETPRA
MKDGTNTMTTQTTSPTTDAGSEWAGSESELEKENKNVNTKN
NT seq 4446 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcctggaactgttgcgtgcgagtgccaatggctgttacaacacaatattctca
gatgcctggagtcaatatgtgtctcagcagattacatcgtcgttgtacctgtacatcgcc
ttgggcattctaaccgtgctctttgtggcctggttcatatattttaaacgtctcgcacgt
ttacggctgcgtgatgaaattgcccgatcattgaacgccgtcacctcagcctctggtggg
gatttgcgcggcttgagatttcgcaaacgcgacaaaatgctcttttatggtcggagaatg
ttgcgcaaaatgaaaaatgtcagcggacagatgtatagcagcggcaagggctacaagagg
cgggccgtaatgcggttcgctcgacgcatacttcagctgcgacgtgagaatatgccgctg
gagatgaggacagtggaaccgccggcggagtatctcgaggagacaatcgagggcagtgat
cgtgtgccaccggatgctctatatatgcttcagagtatacgcatttttgggcactttgag
aagccagtgtttctcaaattatgcaagcacacccaggtgctggagctaatggctggcgat
tatctattcaagatcactgatgccgatgacagtgtctatattgttcaatcgggcatgatc
aatgtatatatctcgaatgcggatggcagcacattgtccctgaagacagtgcgtaaagga
gaatcggtgacatcgctgctcagtttcatcgatgtgctatccggtaatccaagttactat
aaaacggttacggccaaagccatggagaaatccgtcgtaatacgtttacccatgcaggca
tttgaggaggtgttccgtgagaatcccgatgtaatgatacgtgttattcaggtcatcatg
attcgattgcagcgcgtcctttttaccgctctccgcaattatcttggccttaatgctgag
cttgtccagaatcatatgcgcaataagagcataacaatttccggacatctcaactcgcaa
tctcaatcgtcgcaatcgatgcggcagcagacgacagcaacggcaactggtggaacatcg
gcaactgctttggggggtcaacaattgccagccgccgttccatcgttgccgttgcagcga
caaccgccgccgcctaccattgcgccgcctttgcgtcattcacgcgaagagcataccctg
tcgggtccaaatcctaatccaaatagtggcaacaatgttcaattgcctgaagtgcatgga
gatgcgccaaacattgatatctaccatcagcaacaacatggcggtagcacctcgacgggc
aatttgtctactcgacgtggctctttggttcaaccgtcgatcggaggaggaggaggaggg
tcaacggctcaagaaggaggatgtgctgcagctggtgctccaaccatagatatgcgtctc
attcagtcatcggccgtggaaagtttacgcaaagagcttggtctgcccaacgaggatgcg
catataatagagccatttgttgaggtccgtgaactggaacccaatgtcaccctcataacg
gagggcaatgccgatgatgtttgcatatggtttgtgatgaccggcaccttggcggtttac
caaggtgttgcagatgccacacgctcctccactgccaccaccaaatcagataagtctgat
ttgcttatacattttgtccatccgggtgaaattgtcggcggtttggccatgctaaccggc
gaggctagtgcctatacgattcgttcgcgaaataatagtcgtgtggcctatataagacgt
gcggccatttatcagattatgcgacagcgtccacgaatagttttggatctgggcaatggt
gtggtgcgtcgtctctcccccttggtacggcaatgtgattatgccttggactggatcttt
ctagagtccggacgtgccgtctatcgacaggatgagagcagtgatagcacttacattgta
ttgagtggacgtatgcgttcagtaattacgaatccgggtggcaaaaaggaaattgtcggt
gaatatggcaaaggagatctggtgggcattgttgagatgatcacagagacatcacggacc
accactgttatggcggtgcgtgactccgaattggccaaattgccagagggcctgttcaat
gccatcaaattgcgttatccaattgtggttacaaagctaattagttttctaagtcatcgg
tttttgggttccatgcagacacgcggcagcacaggggcaccaggtgcgccagtcgaggct
aatccggtaacgcacaagtattcaacagtggctctggtgcccattacagatgaagtgccg
ctaacgccattcacctatgagctgtatcattcactatgtgccataggccctgttctacgt
ctcacctcggaggtggtacgcaagcagctgggtcaaaacatatttgaggccgcaaatgag
tatcgtttgacctcatggcttgcccagcaagaggatcgtaatattatcacattatatcag
tgtgataattcgttaagtccctggacccatcgttgtatgcgtcaagcggatgtgattcta
attgtcggccttggagatcgttcacatttggttgggaaatttgaacgtgaaatcgatcgt
cttgccatgcgcacacaaaaggagctggtgctcctctatccggagacaacgaatgccaaa
ccagccaatacactcagttggctgaatgctcgtccctgggtaactaagcatcatcatgtg
ctctgtgtgaagcgtatttttacccgcaaaagtcaatatcgaattaatgatctctacagt
cgtgtcctgctatcggagccaaatatgcattccgatttctcacgtttggcccgttggcta
acgggcaactctattggactggtactgggtggtggcggtgctcgaggtgctgcccatatt
ggcatgctgaaagccatacaagaggctggtatacccatcgatatggttggtggggttagc
attggtgccctaatgggtgccctctggtgctccgagagaaatatcaccacagtaacgcaa
aaggcacgccagtggtccaaaaaaatgacaaaatggttcctacaattgctggatcttacc
tatcccattacatcaatgttttcgggccgtgaattcaacaagaccatacatgatacattt
ggtgatgtgagcattgaggatctgtggataccctatttcacactgacaaccgatatcacc
gccagttgccatcgcattcacacaaacggatctctgtggcgttatgtacgctcatccatg
tcgctaagcggctatatgccaccactctgtgatccaaaagatggacatcttctgctggat
ggcggctatgtaaataatttgccaggtcacctgtggcgctattgtcgtgccagtatgtcc
attgccggtgtctttccgcccttctgtgattatcgggatggccatttgctgctcgatggc
tgttatacaaacaatgtgccagctgatgtgatgcacaatttgggagctgctcatataatt
gccattgatgtgggctctcaggatgataccgatctaacaaattatggtgatgatctaagt
ggctggtggttgctctataaaaaatggaatcccttcacctcgccagttaaggtgcccgat
ttgcccgatatacaatctcgtctggcttatgtgtcgtgtgtgagacagcttgaagaggtg
aaaaattcggattactgcgaatatattcgaccgccaattgacaaatacaagacattggcc
tttggcagctttgatgagatacgcgatgtgggctatgtctttggcaaaaactatttcgag
agcatggccaaggcgggtcgtttgggacgtttcaatcaatggttcaacaaggagccaccc
aagcgtggcaatcacgcatcgctcaatgagtatacgtttattgatttagctcaaattgtc
tgcaaattacccgaaacgtatgctgtgaacactgcagagatattcagtgaggatgaggac
tgtgatggttatatatcggagccaagtacgctgaatacggatcgtcgaattcaggtgcca
cgagctggtaactcattatcgttatcagaggctgaaatggattccgatgtggagattgat
ttcagaagcgatagtaaaaaggataaagcaactcaatcaacaccgccggctcctggcaaa
gacaacgaggataaaaccgatgcggtggatagaataccattattaacactagaaaggcca
ttgactgaccagcagcaacagcatagcgacgagactgacgaacaggaaacgccgcgggcg
atgaaagatggcacaaacacaatgacaacccaaacgacgtcacccacaacggatgcgggt
tcggaatgggcgggcagcgagtcggagttagaaaaggagaacaaaaatgtcaataccaaa
aactaa

DBGET integrated database retrieval system