KEGG   Drosophila willistoni: Dwil_GK16217Help
Entry
Dwil_GK16217      CDS       T01067                                 

Definition
(RefSeq) GK16217 gene product from transcript GK16217-RC
  KO
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
dwi  Drosophila willistoni
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dwil_GK16217
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dwil_GK16217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1442 aa AA seqDB search
MDVLELLRASANGCYNTIFSDAWSQYVSQQITSSLYLYIALGILTVLFVAWFIYFKRLAR
LRLRDEIARSLNAVTSASGGDLRGLRFRKRDKMLFYGRRMLRKMKNVSGQMYSSGKGYKR
RAVMRFARRILQLRRENMPLEMRTVEPPAEYLEETIEGSDRVPPDALYMLQSIRIFGHFE
KPVFLKLCKHTQVLELMAGDYLFKITDADDSVYIVQSGMINVYISNADGSTLSLKTVRKG
ESVTSLLSFIDVLSGNPSYYKTVTAKAMEKSVVIRLPMQAFEEVFRENPDVMIRVIQVIM
IRLQRVLFTALRNYLGLNAELVQNHMRNKSITISGHLNSQSQSSQSMRQQTTATATGGTS
ATALGGQQLPAAVPSLPLQRQPPPPTIAPPLRHSREEHTLSGPNPNPNSGNNVQLPEVHG
DAPNIDIYHQQQHGGSTSTGNLSTRRGSLVQPSIGGGGGGSTAQEGGCAAAGAPTIDMRL
IQSSAVESLRKELGLPNEDAHIIEPFVEVRELEPNVTLITEGNADDVCIWFVMTGTLAVY
QGVADATRSSTATTKSDKSDLLIHFVHPGEIVGGLAMLTGEASAYTIRSRNNSRVAYIRR
AAIYQIMRQRPRIVLDLGNGVVRRLSPLVRQCDYALDWIFLESGRAVYRQDESSDSTYIV
LSGRMRSVITNPGGKKEIVGEYGKGDLVGIVEMITETSRTTTVMAVRDSELAKLPEGLFN
AIKLRYPIVVTKLISFLSHRFLGSMQTRGSTGAPGAPVEANPVTHKYSTVALVPITDEVP
LTPFTYELYHSLCAIGPVLRLTSEVVRKQLGQNIFEAANEYRLTSWLAQQEDRNIITLYQ
CDNSLSPWTHRCMRQADVILIVGLGDRSHLVGKFEREIDRLAMRTQKELVLLYPETTNAK
PANTLSWLNARPWVTKHHHVLCVKRIFTRKSQYRINDLYSRVLLSEPNMHSDFSRLARWL
TGNSIGLVLGGGGARGAAHIGMLKAIQEAGIPIDMVGGVSIGALMGALWCSERNITTVTQ
KARQWSKKMTKWFLQLLDLTYPITSMFSGREFNKTIHDTFGDVSIEDLWIPYFTLTTDIT
ASCHRIHTNGHLWRYCRASMSIAGVFPPFCDYRDGHLLLDGCYTNNVPADVMHNLGAAHI
IAIDVGSQDDTDLTNYGDDLSGWWLLYKKWNPFTSPVKVPDLPDIQSRLAYVSCVRQLEE
VKNSDYCEYIRPPIDKYKTLAFGSFDEIRDVGYVFGKNYFESMAKAGRLGRFNQWFNKEP
PKRGNHASLNEYTFIDLAQIVCKLPETYAVNTAEIFSEDEDCDGYISEPSTLNTDRRIQV
PRAGNSLSLSEAEMDSDVEIDFRSDSKKDKATQSTPPAPGKDNEDKTDAVDRIPLLTLER
PLTDQQQQHSDETDEQETPRAMKDGTNTMTTQTTSPTTDAGSEWAGSESELEKENKNVNT
KN
NT seq 4329 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcctggaactgttgcgtgcgagtgccaatggctgttacaacacaatattctca
gatgcctggagtcaatatgtgtctcagcagattacatcgtcgttgtacctgtacatcgcc
ttgggcattctaaccgtgctctttgtggcctggttcatatattttaaacgtctcgcacgt
ttacggctgcgtgatgaaattgcccgatcattgaacgccgtcacctcagcctctggtggg
gatttgcgcggcttgagatttcgcaaacgcgacaaaatgctcttttatggtcggagaatg
ttgcgcaaaatgaaaaatgtcagcggacagatgtatagcagcggcaagggctacaagagg
cgggccgtaatgcggttcgctcgacgcatacttcagctgcgacgtgagaatatgccgctg
gagatgaggacagtggaaccgccggcggagtatctcgaggagacaatcgagggcagtgat
cgtgtgccaccggatgctctatatatgcttcagagtatacgcatttttgggcactttgag
aagccagtgtttctcaaattatgcaagcacacccaggtgctggagctaatggctggcgat
tatctattcaagatcactgatgccgatgacagtgtctatattgttcaatcgggcatgatc
aatgtatatatctcgaatgcggatggcagcacattgtccctgaagacagtgcgtaaagga
gaatcggtgacatcgctgctcagtttcatcgatgtgctatccggtaatccaagttactat
aaaacggttacggccaaagccatggagaaatccgtcgtaatacgtttacccatgcaggca
tttgaggaggtgttccgtgagaatcccgatgtaatgatacgtgttattcaggtcatcatg
attcgattgcagcgcgtcctttttaccgctctccgcaattatcttggccttaatgctgag
cttgtccagaatcatatgcgcaataagagcataacaatttccggacatctcaactcgcaa
tctcaatcgtcgcaatcgatgcggcagcagacgacagcaacggcaactggtggaacatcg
gcaactgctttggggggtcaacaattgccagccgccgttccatcgttgccgttgcagcga
caaccgccgccgcctaccattgcgccgcctttgcgtcattcacgcgaagagcataccctg
tcgggtccaaatcctaatccaaatagtggcaacaatgttcaattgcctgaagtgcatgga
gatgcgccaaacattgatatctaccatcagcaacaacatggcggtagcacctcgacgggc
aatttgtctactcgacgtggctctttggttcaaccgtcgatcggaggaggaggaggaggg
tcaacggctcaagaaggaggatgtgctgcagctggtgctccaaccatagatatgcgtctc
attcagtcatcggccgtggaaagtttacgcaaagagcttggtctgcccaacgaggatgcg
catataatagagccatttgttgaggtccgtgaactggaacccaatgtcaccctcataacg
gagggcaatgccgatgatgtttgcatatggtttgtgatgaccggcaccttggcggtttac
caaggtgttgcagatgccacacgctcctccactgccaccaccaaatcagataagtctgat
ttgcttatacattttgtccatccgggtgaaattgtcggcggtttggccatgctaaccggc
gaggctagtgcctatacgattcgttcgcgaaataatagtcgtgtggcctatataagacgt
gcggccatttatcagattatgcgacagcgtccacgaatagttttggatctgggcaatggt
gtggtgcgtcgtctctcccccttggtacggcaatgtgattatgccttggactggatcttt
ctagagtccggacgtgccgtctatcgacaggatgagagcagtgatagcacttacattgta
ttgagtggacgtatgcgttcagtaattacgaatccgggtggcaaaaaggaaattgtcggt
gaatatggcaaaggagatctggtgggcattgttgagatgatcacagagacatcacggacc
accactgttatggcggtgcgtgactccgaattggccaaattgccagagggcctgttcaat
gccatcaaattgcgttatccaattgtggttacaaagctaattagttttctaagtcatcgg
tttttgggttccatgcagacacgcggcagcacaggggcaccaggtgcgccagtcgaggct
aatccggtaacgcacaagtattcaacagtggctctggtgcccattacagatgaagtgccg
ctaacgccattcacctatgagctgtatcattcactatgtgccataggccctgttctacgt
ctcacctcggaggtggtacgcaagcagctgggtcaaaacatatttgaggccgcaaatgag
tatcgtttgacctcatggcttgcccagcaagaggatcgtaatattatcacattatatcag
tgtgataattcgttaagtccctggacccatcgttgtatgcgtcaagcggatgtgattcta
attgtcggccttggagatcgttcacatttggttgggaaatttgaacgtgaaatcgatcgt
cttgccatgcgcacacaaaaggagctggtgctcctctatccggagacaacgaatgccaaa
ccagccaatacactcagttggctgaatgctcgtccctgggtaactaagcatcatcatgtg
ctctgtgtgaagcgtatttttacccgcaaaagtcaatatcgaattaatgatctctacagt
cgtgtcctgctatcggagccaaatatgcattccgatttctcacgtttggcccgttggcta
acgggcaactctattggactggtactgggtggtggcggtgctcgaggtgctgcccatatt
ggcatgctgaaagccatacaagaggctggtatacccatcgatatggttggtggggttagc
attggtgccctaatgggtgccctctggtgctccgagagaaatatcaccacagtaacgcaa
aaggcacgccagtggtccaaaaaaatgacaaaatggttcctacaattgctggatcttacc
tatcccattacatcaatgttttcgggccgtgaattcaacaagaccatacatgatacattt
ggtgatgtgagcattgaggatctgtggataccctatttcacactgacaaccgatatcacc
gccagttgccatcgcattcacacaaacggtcacctgtggcgctattgtcgtgccagtatg
tccattgccggtgtctttccgcccttctgtgattatcgggatggccatttgctgctcgat
ggctgttatacaaacaatgtgccagctgatgtgatgcacaatttgggagctgctcatata
attgccattgatgtgggctctcaggatgataccgatctaacaaattatggtgatgatcta
agtggctggtggttgctctataaaaaatggaatcccttcacctcgccagttaaggtgccc
gatttgcccgatatacaatctcgtctggcttatgtgtcgtgtgtgagacagcttgaagag
gtgaaaaattcggattactgcgaatatattcgaccgccaattgacaaatacaagacattg
gcctttggcagctttgatgagatacgcgatgtgggctatgtctttggcaaaaactatttc
gagagcatggccaaggcgggtcgtttgggacgtttcaatcaatggttcaacaaggagcca
cccaagcgtggcaatcacgcatcgctcaatgagtatacgtttattgatttagctcaaatt
gtctgcaaattacccgaaacgtatgctgtgaacactgcagagatattcagtgaggatgag
gactgtgatggttatatatcggagccaagtacgctgaatacggatcgtcgaattcaggtg
ccacgagctggtaactcattatcgttatcagaggctgaaatggattccgatgtggagatt
gatttcagaagcgatagtaaaaaggataaagcaactcaatcaacaccgccggctcctggc
aaagacaacgaggataaaaccgatgcggtggatagaataccattattaacactagaaagg
ccattgactgaccagcagcaacagcatagcgacgagactgacgaacaggaaacgccgcgg
gcgatgaaagatggcacaaacacaatgacaacccaaacgacgtcacccacaacggatgcg
ggttcggaatgggcgggcagcgagtcggagttagaaaaggagaacaaaaatgtcaatacc
aaaaactaa

DBGET integrated database retrieval system