KEGG   Drosophila willistoni: Dwil_GK16232Help
Entry
Dwil_GK16232      CDS       T01067                                 

Definition
GK16232 gene product from transcript GK16232-RA
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dwi  Drosophila willistoni
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dwil_GK16232
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     Dwil_GK16232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 694 aa AA seqDB search
MTASTTSSNQATGKATVPTVVPQPIGKDMESTQATQSESQSQDQPLQELSEIFFVENNRR
KQSIRIQVKLCPEGVYLRRQTEQDDHINEQLIRIDDIIGSRYGSRLKKRARGGLSSCKNP
NANVPEPEDEQPQAAGTGKDNSAFLYIYAYLKKEKPLRRVQTLRILRFRSSNDFAENLRT
AELWHHTIRQHKLQRSGNSGEKQLLILLNPKSGSGKGRELFQKQVAPLLREAEAQYDLQI
TTHPNYAQEFVRTNKNLLERYSGIVVASGDGLFYEVLNGLMERMDWRRVCRELPLGIIPC
GSGNGLAKSVAHHCNEPYEPKPILHATLTCVAGKSTPMDVVRVELSRRDKHYVMYSFLSV
GWGLIADIDIESERLRSIGAQRFTLWAIRRLITLRSYKGKLYYKLGKTEGKSTEAKSSTE
AEPPAPPKTQNVELREETSAPITQQQQIDESNRLASQRLSLPINSPEFKDIPDDDDDAAT
AAADNETIARNAVDDEFSDVMSLNRSIYRQHADSWHSAVSRRTAYYSVGGQSTRSNRSRL
SVAQKIEDANAEFAELVPTGTMPGLQLPLPSADGWISEEGEFVMVHAAYTTHLASDCFFA
PDSRLNDGLIYLVIIRAGVGRPQLLNFLLSMNSGTHLPETNNDPYIQVVAVEAFRIEPSG
NQGILTVDGERVDYGPIQAEVFPGMIKVMTTNGE
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgacggccagtacgacaagtagcaatcaggcaacaggtaaagctacagtcccaactgtt
gtgccccaacccattggcaaggatatggaatcaacacaggcaacacagtcagagtcgcag
tcacaggatcaacccttgcaagagcttagcgaaatcttctttgtggaaaacaatcgacgc
aaacagagcatacgcatccaggtgaaactatgtccggaaggtgtctatttgcgtcgccag
accgaacaggatgatcacattaatgagcagttaatacgtattgatgatattatcggttcc
cgttatggttcacgtttgaagaaacgtgcccgcggcggtttaagctcgtgcaagaatccc
aatgccaatgtacccgaaccggaggatgagcagccacaagcggcaggcacgggcaaggat
aacagcgcctttctatacatctatgcgtacctgaagaaggagaagccactgcgtcgtgtc
cagacattgcgcattttacgttttcgctcaagcaatgactttgccgagaatttgcgcaca
gccgaactttggcatcatacaatacgtcagcataaattgcaaaggagtgggaatagtggg
gagaaacagctgctaatcttactcaatcccaagtcgggatcaggcaagggacgcgaactg
ttccagaaacaggtggccccactattgcgtgaagcggaggcgcaatacgacttgcagatc
acaacacatccgaactatgctcaggaatttgtgaggaccaacaaaaatctgcttgaacgt
tattccggcattgtggttgcctccggcgatggcctcttctatgaggtgctcaatggtctg
atggagcgcatggattggcggcgagtgtgtcgcgaattgccactgggcatcataccgtgc
ggttcgggcaacggtctggccaagagtgtggcccatcattgcaatgagccgtacgaacca
aagcccattctgcatgctactcttacctgtgtggccggcaaatctacgcccatggatgtg
gttcgtgtggaattgtcacggcgggacaagcattacgtgatgtattcgtttttgtcggtt
ggctggggcttgattgctgatatcgacatcgaaagcgaacgcttgcgttcgattggtgcc
caacggtttacattgtgggccatcagacgattaatcacattgagaagttacaagggcaaa
ctgtattataaattgggtaaaacggagggaaagtcaactgaagccaaatcatcaactgaa
gcggagccaccagcaccaccaaagacacaaaacgtcgagttacgagaggaaacatcggcg
ccgataacacaacaacaacaaatcgatgaatccaatcgattagcatcgcaacgtctctcg
ctgcccattaattcgcccgaatttaaggatatccccgatgatgatgatgatgctgctact
gctgctgctgataatgaaacgatcgccaggaatgccgttgacgatgaattttccgatgtt
atgtccctaaatcgatcaatttatcgccagcatgccgatagttggcactcggcagtatca
cgacgaactgcctactactcggtgggaggacaaagtactcgctcgaatcgcagccgtttg
agtgtggcccaaaagatcgaagatgccaatgccgagttcgctgaactagtgcccactggc
acaatgccgggactacaattgcctctaccttcagcagatggttggatatctgaggaaggg
gagttcgtaatggttcatgcagcatacacaacacatttggcatccgattgcttctttgcc
cccgactcacgactcaacgatggcctaatctatttggtcattatacgggcgggggtcggt
cgaccgcagttacttaattttctactcagcatgaacagtggcactcatttacccgagacc
aataatgatccctacatacaggtggtggccgtggaagcttttcgcattgaaccgagtggc
aaccagggcattcttacggtcgatggtgagcgagtggactatggacccattcaggctgag
gtatttccgggcatgatcaaggttatgaccacaaatggcgaataa

DBGET integrated database retrieval system