KEGG   Drosophila willistoni: Dwil_GK16263Help
Entry
Dwil_GK16263      CDS       T01067                                 

Definition
(RefSeq) GK16263 gene product from transcript GK16263-RB
  KO
K14310  
nuclear pore complex protein Nup205
Organism
dwi  Drosophila willistoni
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dwil_GK16263
Messenger RNA biogenesis [BR:dwi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dwil_GK16263
Chromosome [BR:dwi03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    Dwil_GK16263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 2044 aa AA seqDB search
MDGITEDMWAPYKHLYGVIQSALNNPKAVTSDLELCLKRYKQNFTNFLRNPPKSEKSRSQ
LRNAVMQDGIQLNGQSRKVQISQEIVDEALILSDMFDLDEIFAVELLCTAQRQQMHHPGL
PRGLVAVLLYYDGRKAMSCALRDIFQVVAGVAWSTELPREITYLITNFSQSLVDDTNILG
RLLELLTDMDIDKESLMLTKNRAFGSKKHQNRVLGMYEDIRKSLAMSLFNWSAQRGLPKP
IAIRLLQYLANSKAVDASGCIDDITLTMLMALLYSYDTSVLLHNENQSSYTSRLPIFTDQ
DFAKGFHDAIYGQNNWQSPRLDCIIKYSFGLTLASLRHAPSNLQAAAGDIINRDEQLIDE
ALAANIFGFFYRQLLEKEIVYTTEFFYRRVHMLITDFIDFMHAKVSELRGRADESARTVI
SFTNEGLEPPANLDTNFELLMLCVAKLYGDKRSCINLCNEYWGPADSNNGNYLKNTSRSV
SLFKFISLASELLPQTLFKSYLKMLTGLTRTKFSARCAFNLLKNSQSGTSTYAVSWDHFF
TALTNYYNNVRKELNENSGTGDTIYRSRAMPRSMTQREAEHLLAVMGIIQSVTEYDEISR
LMICEHSNWQTPQVLLGLITCSTPLVLKAKLLFTLAALAKSKDTARAIWFHLEESQIIPT
LPVASTYTQSSLAEEIEQNESRLETYEMSRGILHLLHTLMTTHMPKSLGVGSRKPGYDAY
FNFILDTILLKFYNRAYKDPAEKWEVGAKCLKLLYFLLATYQPRASDFLEQRDEHPYPGY
HIMLRLHIKSDMLRLLLRLIEESRERLDDYNDFRGKEFLEECSLYALLMLEMAVSKQNAF
FEAHSTANCPILLSGLNRMLLDLNPRSRKPDYVLNITKYVTYNSWLPRHTLAAIKILGAV
TVLPNVAGQILTMYAQGSNEKLEIRQGFVECLEMDCNLPPSHDELLEQLNLINPYEGAAP
PTESENSSSLETKKPLRIELQIKEAIVELFLLNLNQPLPNFVCFLLGIDVLRDFMANEKQ
QLGIEMNCACLNSLVLAQEKYLEKQRNVDEYCEHTAHLVERIYNLLYGLCANRRTSETIL
RYFRLSCNDFLLRHLNSMPFRHPREEHILHAMSHLLNCVAIEIKLAAVHGQTTRYNLLCD
ILLASNPDPQQRNIHSLPLELTQPTSNFYGVDGTCVGDGAINLTLMQEHALGLHANRMLD
CLTFDSHALSQPRLEFFDSRLISQVLKDCEAPNASAAAVSAACSGGGSQGSTSLINIRKL
HDILHDELRMVQSTIASGQRKAITVEIATLLQHGIEINRIRTHRWATLNFMNAWCQVVQI
LFSSMPEAVLQIAVRRQYIIDIIEKILMKVQPMQPLIEISIQITETVLLLLANLRYCCHL
MEDQGMLDDQNRDQTTDSNGGASIAPDHGGGGGGGGSVDGVFMAKMAKKSPIFGNNNGSN
NNIRFILKKLVEWIMVSEVKSQKLRINLYSALLNCLRIVKRLRSDDHLGYHENLVSRLDS
SRGYNHLQLGDELMQQKEMAAEVIGAFGEKLIDTICHDAVTGHDICRMLALACLDMISEL
NAVSTLSEFITVRGYLKNILDSLAKSTEDLCGILQPVPDNLRALYVYESRMSFLTRIAQT
SVGAHLLLGERVLGVLSNMRVYDMQPDLKASELKRNFPKEFLPNIDERFRAILLPALALC
DAIMNSLGSTNMSASLQILNFLFAHIDMVEAMLRSATPFMDLCHLQQLAAITNLFARTTT
HDVTTLEDGLDVQNDMELRCRLSCLQQLMIVVFGRFTVSEQSIRQMINQQQQHHHQHHHH
LHEYEYDESQQSLHIKYFLDIAANLSLYCRNAVTSHEKDGMTSKYLLTTMINDITPLTGK
SDGKKLTAIMHTILNQLKGSIGYYLSQKSIADNLLQQRASLPNITFGPNGKQSYLELSQR
HNEKRSELMQAVFIAEQNLYLLWIHLDFYLRNAVLYIQENRNAINESNLDPTNLSVLYAS
QDEVLQLKQLLISTFNETFCTQLINASEEYTVKCKGFNASLLRRIKALVQFAPVQEQATI
LYRK
NT seq 6135 nt NT seq  +upstreamnt  +downstreamnt
atggacggtataaccgaggacatgtgggcgccgtacaagcatttatatggtgtaatacaa
tcggctttaaataatcccaaggcagttacctccgatctagagctatgtctcaagagatat
aaacaaaactttacgaatttcctaaggaacccgcccaaaagcgaaaagagtcgcagccag
ctaaggaatgctgtgatgcaggatggcattcaattgaatgggcaaagtcgcaaggtacaa
atctcacaggaaattgtcgatgaggctctcatattgtcggatatgtttgatctggatgag
atttttgctgtggaactattgtgcacagcgcaacggcaacagatgcatcatcccggtctg
ccgcgtggtcttgtcgctgttttattgtactatgatggccgtaaggcaatgagttgtgcc
ctccgggatatatttcaagttgtcgccggcgttgcctggagcacagaattgccacgtgag
ataacctacctgataacaaacttttctcaaagtctcgttgatgatacaaatatcttgggt
cgtctgttggagttacttaccgatatggacattgataaggagagcctgatgttgacaaag
aatcgggcatttggctcaaagaagcatcagaatcgtgtcttgggcatgtacgaggatata
cgtaaatctcttgccatgtccctattcaattggtcagctcaacgtggtttgcccaagcca
attgccatacgtctgcttcagtatttggccaatagcaaggcagtcgatgcctctggctgc
atcgatgatatcacattaacaatgttaatggcattgctatactcgtatgacacatccgtg
ttgcttcataacgaaaatcaaagctcctacacatcacgactgcccatttttactgatcag
gactttgcaaagggctttcatgatgccatttacggacagaacaattggcaatcgcctcga
ttggattgcattatcaagtatagttttggtctaactttggccagtttaaggcatgcacca
agcaatcttcaagcagctgccggtgacattatcaatcgagatgaacaattaattgatgag
gcattggctgccaatatatttggtttcttctatcgtcagttactcgaaaaggagattgtt
tacaccactgaattcttttatcgtcgtgtccatatgctcatcacagatttcatagatttc
atgcatgccaaagtttccgagttacgtggtcgtgcagatgaatctgcacgcacggttatt
agcttcaccaatgaaggacttgaacctcctgccaatttggatacaaattttgagctactc
atgctgtgtgttgccaaattgtatggtgataaacgttcctgcattaatctctgcaatgaa
tattggggaccagcagatagtaataatggcaactatttgaagaatacatcacgttccgtt
tcgctgttcaagtttattagtttggccagtgaattgttgccacaaactctatttaagtcg
tatctaaagatgttaaccggcctaacacggaccaaattctcggccagatgtgcttttaac
ttgttaaagaattcacagtctggcacatccacctatgccgtcagttgggatcactttttc
acagccctcaccaactattacaacaatgttcgaaaagaattgaatgagaatagtggaact
ggtgataccatttatcgtagtcgcgccatgcccagaagtatgacccaacgggaggcggaa
catctgttggctgtcatgggtattatacaatcggtgaccgaatacgatgagatctctaga
cttatgatctgtgagcattcaaactggcagacaccgcaagttcttttgggtttaatcacc
tgctccacgcctttggtcctcaaggcgaaattgctcttcactctggctgcgctggcgaaa
tcaaaggatacggcacgagccatctggttccatttggaggaatcacagattataccaacc
ctaccggtggcgagtacatacacacaatccagtttggccgaagagatcgaacagaatgag
agccgcctggagacatatgagatgagtcggggaattctccatctgcttcacactctaatg
accacacatatgccaaagagtttgggcgttggttcacgtaaaccaggctatgatgcgtat
ttcaatttcattttggacaccatactcttgaaattctacaatcgggcatacaaagatccc
gccgagaaatgggaagtgggtgcaaaatgtttgaaacttttatacttcctcttggccaca
tatcagccccgtgcttctgatttccttgagcaacgcgacgagcatccctatcctggctat
cacataatgttgcgtctacatattaaatcggatatgttgcgtcttttgctacgccttatc
gaagagtcacgcgaacgtctggatgattataatgattttcgtggcaaagagtttctcgag
gaatgttccctgtatgctctactcatgctcgagatggcggtgtccaaacagaatgccttc
ttcgaggcccattcgacagcgaattgcccgattttgttatcgggcctaaatcgcatgctt
cttgacctgaatccacgtagtcgtaaaccagattatgtgctaaatatcaccaaatatgta
acctacaacagttggctgccgcgtcatacattggcggcaattaaaatacttggcgctgtc
actgtcctgcccaatgttgccggccaaatcctaaccatgtatgcccagggctcaaacgag
aagcttgagatacgacaaggttttgttgaatgcctggaaatggattgcaatttgccacca
tcacatgatgagctattggagcaattgaatctgattaatccatatgagggggcagctcct
ccaacggaaagtgaaaatagcagcagtctggagacgaagaaaccattgcgcattgaattg
caaattaaagaggcaattgttgaactatttctattgaatctcaatcaaccgttgccgaat
tttgtatgcttccttttgggtatcgatgtgctgcgtgattttatggccaatgagaagcaa
caattgggcattgagatgaattgtgcgtgtttaaattcattggtattggcacaggaaaag
tatttagagaaacaacgaaatgttgatgaatattgtgaacatacagcccatttggtggaa
cgtatatataatctactttatggcctatgtgccaatcgtcgtacatcggagacaatttta
cgctatttccgcttgtcatgtaatgacttccttttacgtcatttgaactcaatgcccttc
cgtcatcccagagaagaacatattctgcatgccatgagccatctactcaattgtgttgca
attgaaatcaaattggctgccgtccatggccagacgacacgctataatctactctgtgac
attctactggccagcaatccggatccacagcaacgaaatatccactcattgcccttggaa
ttaacccaaccgacatcgaatttctatggcgtcgatggcacttgcgtgggcgatggtgcc
attaatttgaccctaatgcaagagcatgccctgggtttgcatgcgaatcgtatgctggat
tgtctaacattcgattcccatgcattaagccagccgcgtttggaattctttgatagtcgg
ctgatatcacaggttctcaaggattgcgaggcaccaaatgcaagtgccgcagctgtttct
gctgcctgttctggtggcggtagtcagggatcgaccagtttaatcaacatacgtaaatta
catgacatactgcacgatgaattgcgcatggtacagagcaccatagccagtggccagcgc
aaggcaatcactgtagagatagccactctattgcagcatggcatagagatcaatcgcata
cggacacatcgttgggctacattaaactttatgaacgcctggtgtcaggtggttcagatt
ctatttagcagcatgcccgaagctgtgctacagattgctgtgcgacgtcagtatatcatc
gatatcattgagaagattctaatgaaggtgcaaccgatgcaaccgttaatcgagatttcg
atacagataaccgaaacggttttactcttattggccaatctgcgttattgctgtcatcta
atggaggatcagggcatgctggatgatcagaacagagatcagacaactgattcaaatggt
ggtgcttcaattgctcctgatcatggtggtggtggtggtggtggtggtagtgtcgatggt
gtgttcatggccaagatggccaaaaaatcaccgatttttggtaataataatggcagcaat
aataatatacgtttcattttgaaaaaacttgtcgaatggataatggttagcgaagtgaaa
tcacagaaattgcgcatcaatctctatagtgctctactcaattgtctgcgcattgtgaaa
cgtttgcgtagcgatgatcatttgggttatcatgaaaatttggtttcccgtttggatagc
tcaaggggttataatcatttacaacttggcgatgagttgatgcaacaaaaggaaatggct
gccgaagtgattggagcatttggtgaaaaactaattgatacaatttgccatgatgctgtt
acaggacatgatatatgccgtatgttggcattggcatgcctcgatatgatatctgaattg
aatgcggttagcacgttgagtgaattcattacggtgcgtggctatctgaagaatatactc
gatagcctggctaaatcgacagaggatttgtgtggaatactccaaccggtgcccgataat
ctgcgtgccctgtatgtctatgagtcgcgtatgtcgttccttacgcgcatcgcccagaca
agtgtcggtgcacatttgctgctgggcgaacgggtattgggtgtgctatcgaatatgagg
gtatatgatatgcaacccgatctcaaggccagcgaattgaaaagaaatttccccaaagaa
ttcttacccaatattgatgaacgtttccgtgctatattattgccagcattggcattatgt
gatgccattatgaattcattgggatcgacaaatatgtcggcatcgttgcagatattgaat
tttctattcgcccacattgatatggttgaggcaatgctgcgctctgcaacaccattcatg
gatttatgccacctgcagcaattggcggcgataacgaatctatttgcacgtaccacaacg
cacgatgtgaccacattggaggatggtctggatgtacaaaacgatatggaactgaggtgt
cgtttgagttgtctgcaacaattgatgattgtggtttttggtagattcacggttagtgaa
caaagtatacgacaaatgataaatcaacagcaacaacaccatcatcagcatcatcatcat
ctgcatgaatatgagtatgatgaaagtcaacagagtttacatatcaaatactttttggat
attgctgccaatctatccttatattgtcgcaatgctgtaacaagtcatgaaaaggatggc
atgacatccaaatatcttttaaccacaatgatcaacgatataacaccattaactggcaaa
tcagatggcaagaaactaactgccattatgcataccatattgaatcaactgaaaggatcc
attggctattatctatcacagaaatccattgccgataatctattgcaacagagagcatcg
ttacccaacattacatttggaccaaatggcaaacaaagttatttggaacttagccagcga
cacaatgagaaacgcagtgaactgatgcaagccgtttttatagccgaacaaaatttgtat
ttactttggatacatttagacttttatttacgcaatgccgtattgtatatccaagagaat
cgtaatgccattaacgagagcaatttggatccaacaaatctatctgtactatatgcctcg
caggatgaagttcttcaattgaaacaattgctcatctccacattcaacgaaacattctgc
actcagctgatcaatgccagcgaagaatatacggtcaagtgtaaggggttcaatgcctca
cttttgcgtcgtattaaggcgctggtgcaatttgctccagtgcaggagcaggccacaata
ttatatagaaaatga

DBGET integrated database retrieval system