KEGG   Drosophila willistoni: Dwil_GK16263Help
Entry
Dwil_GK16263      CDS       T01067                                 

Definition
GK16263 gene product from transcript GK16263-RA
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
dwi  Drosophila willistoni
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dwil_GK16263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2069 aa AA seqDB search
MDGITEDMWAPYKHLYGVIQSALNNPKAVTSDLELCLKRYKQNFTNFLRNPPKSEKSRSQ
LRNAVMQDGIQLNGQSRKVQISQEIVDEALILSDMFDLDEIFAVELLCTAQRQQMHHPGL
PRGLVAVLLYYDGRKAMSCALRDIFQVVAGVAWSTELPREITYLITNFSQSLVDDTNILG
RLLELLTDMDIDKESLMLTKNRAFGSKKHQNRVLGMYEDIRKSLAMSLFNWSAQRGLPKP
IAIRLLQYLANSKAVDASGCIDDITLTMLMALLYSYDTSVLLHNENQSSYTSRLPIFTDQ
DFAKGFHDAIYGQNNWQSPRLDCIIKYSFGLTLASLRHAPSNLQAAAGDIINRDEQLIDE
ALAANIFGFFYRQLLEKEIVYTTEFFYRRVHMLITDFIDFMHAKVSELRGRADESARTVI
SFTNEGLEPPANLDTNFELLMLCVAKLYGDKRSCINLCNEYWGPADSNNGNYLKNTSRSV
SLFKFISLASELLPQTLFKSYLKMLTGLTRTKFSARCAFNLLKNSQSGTSTYAVSWDHFF
TALTNYYNNMRNDVNFSSMGAVGGGVGGGGGAGVAGGIGGGFSGTGDTIYRSRAMPRSMT
QREAEHLLAVMGIIQSVTEYDEISRLMICEHSNWQTPQVLLGLITCSTPLVLKAKLLFTL
AALAKSKDTARAIWFHLEESQIIPTLPVASTYTQSSLAEEIEQNESRLETYEMSRGILHL
LHTLMTTHMPKSLGVGSRKPGYDAYFNFILDTILLKFYNRAYKDPAEKWEVGAKCLKLLY
FLLATYQPRASDFLEQRDEHPYPGYHIMLRLHIKSDMLRLLLRLIEESRERLDDYNDFRG
KEFLEECSLYALLMLEMAVSKQNAFFEAHSTANCPILLSGLNRMLLDLNPRSRKPDYVLN
ITKYVTYNSWLPRHTLAAIKILGAVTVLPNVAGQILTMYAQGSNEKLEIRQGFVECLEMD
CNLPPSHDELLEQLNLINPYEGAAPPTESENSSSLETKKPLRIELQIKEAIVELFLLNLN
QPLPNFVCFLLGIDVLRDFMANEKQQLGIEMNCACLNSLVLAQEKYLEKQRNVDEYCEHT
AHLVERIYNLLYGLCANRRTSETILRYFRLSCNDFLLRHLNSMPFRHPREEHILHAMSHL
LNCVAIEIKLAAVHGQTTRYNLLCDILLASNPDPQQRNIHSLPLELTQPTSNFYGVDGTC
VGDGAINLTLMQEHALGLHANRMLDCLTFDSHALSQPRLEFFDSRLISQVLKDCEAPNAS
AAAVSAACSGGGSQGSTSLINIRKLHDILHDELRMVQSTIASGQRKAITVEIATLLQHGI
EINRIRTHRWATLNFMNAWCQVVQILFSSMPEAVLQIAVRRQYIIDIIEKILMKVQPMQP
LIEISIQITETVLLLLANLRYCCHLMEDQGMLDDQNRDQTTDSNGGASIAPDHGGGGGGG
GSVDGVFMAKMAKKSPIFGNNNGSNNNIRFILKKLVEWIMVSEVKSQKLRINLYSALLNC
LRIVKRLRSDDHLGYHENLVSRLDSSRGYNHLQLGDELMQQKEMAAEVIGAFGEKLIDTI
CHDAVTGHDICRMLALACLDMISELNAVSTLSEFITVRGYLKNILDSLAKSTEDLCGILQ
PVPDNLRALYVYESRMSFLTRIAQTSVGAHLLLGERVLGVLSNMRVYDMQPDLKASELKR
NFPKEFLPNIDERFRAILLPALALCDAIMNSLGSTNMSASLQILNFLFAHIDMVEAMLRS
ATPFMDLCHLQQLAAITNLFARTTTHDVTTLEDGLDVQNDMELRCRLSCLQQLMIVVFGR
FTVSEQSIRQMINQQQQHHHQHHHHLHEYEYDESQQSLHIKYFLDIAANLSLYCRNAVTS
HEKDGMTSKYLLTTMINDITPLTGKSDGKKLTAIMHTILNQLKGSIGYYLSQKSIADNLL
QQRASLPNITFGPNGKQSYLELSQRHNEKRSELMQAVFIAEQNLYLLWIHLDFYLRNAVL
YIQENRNAINESNLDPTNLSVLYASQDEVLQLKQLLISTFNETFCTQLINASEEYTVKCK
GFNASLLRRIKALVQFAPVQEQATILYRK
NT seq 6210 nt NT seq  +upstreamnt  +downstreamnt
atggacggtataaccgaggacatgtgggcgccgtacaagcatttatatggtgtaatacaa
tcggctttaaataatcccaaggcagttacctccgatctagagctatgtctcaagagatat
aaacaaaactttacgaatttcctaaggaacccgcccaaaagcgaaaagagtcgcagccag
ctaaggaatgctgtgatgcaggatggcattcaattgaatgggcaaagtcgcaaggtacaa
atctcacaggaaattgtcgatgaggctctcatattgtcggatatgtttgatctggatgag
atttttgctgtggaactattgtgcacagcgcaacggcaacagatgcatcatcccggtctg
ccgcgtggtcttgtcgctgttttattgtactatgatggccgtaaggcaatgagttgtgcc
ctccgggatatatttcaagttgtcgccggcgttgcctggagcacagaattgccacgtgag
ataacctacctgataacaaacttttctcaaagtctcgttgatgatacaaatatcttgggt
cgtctgttggagttacttaccgatatggacattgataaggagagcctgatgttgacaaag
aatcgggcatttggctcaaagaagcatcagaatcgtgtcttgggcatgtacgaggatata
cgtaaatctcttgccatgtccctattcaattggtcagctcaacgtggtttgcccaagcca
attgccatacgtctgcttcagtatttggccaatagcaaggcagtcgatgcctctggctgc
atcgatgatatcacattaacaatgttaatggcattgctatactcgtatgacacatccgtg
ttgcttcataacgaaaatcaaagctcctacacatcacgactgcccatttttactgatcag
gactttgcaaagggctttcatgatgccatttacggacagaacaattggcaatcgcctcga
ttggattgcattatcaagtatagttttggtctaactttggccagtttaaggcatgcacca
agcaatcttcaagcagctgccggtgacattatcaatcgagatgaacaattaattgatgag
gcattggctgccaatatatttggtttcttctatcgtcagttactcgaaaaggagattgtt
tacaccactgaattcttttatcgtcgtgtccatatgctcatcacagatttcatagatttc
atgcatgccaaagtttccgagttacgtggtcgtgcagatgaatctgcacgcacggttatt
agcttcaccaatgaaggacttgaacctcctgccaatttggatacaaattttgagctactc
atgctgtgtgttgccaaattgtatggtgataaacgttcctgcattaatctctgcaatgaa
tattggggaccagcagatagtaataatggcaactatttgaagaatacatcacgttccgtt
tcgctgttcaagtttattagtttggccagtgaattgttgccacaaactctatttaagtcg
tatctaaagatgttaaccggcctaacacggaccaaattctcggccagatgtgcttttaac
ttgttaaagaattcacagtctggcacatccacctatgccgtcagttgggatcactttttc
acagccctcaccaactattacaacaacatgcgcaatgatgtcaactttagtagcatgggt
gctgttggcggaggagttggtggtggtggtggtgctggcgttgcaggtggcattggcggt
gggtttagtggaactggtgataccatttatcgtagtcgcgccatgcccagaagtatgacc
caacgggaggcggaacatctgttggctgtcatgggtattatacaatcggtgaccgaatac
gatgagatctctagacttatgatctgtgagcattcaaactggcagacaccgcaagttctt
ttgggtttaatcacctgctccacgcctttggtcctcaaggcgaaattgctcttcactctg
gctgcgctggcgaaatcaaaggatacggcacgagccatctggttccatttggaggaatca
cagattataccaaccctaccggtggcgagtacatacacacaatccagtttggccgaagag
atcgaacagaatgagagccgcctggagacatatgagatgagtcggggaattctccatctg
cttcacactctaatgaccacacatatgccaaagagtttgggcgttggttcacgtaaacca
ggctatgatgcgtatttcaatttcattttggacaccatactcttgaaattctacaatcgg
gcatacaaagatcccgccgagaaatgggaagtgggtgcaaaatgtttgaaacttttatac
ttcctcttggccacatatcagccccgtgcttctgatttccttgagcaacgcgacgagcat
ccctatcctggctatcacataatgttgcgtctacatattaaatcggatatgttgcgtctt
ttgctacgccttatcgaagagtcacgcgaacgtctggatgattataatgattttcgtggc
aaagagtttctcgaggaatgttccctgtatgctctactcatgctcgagatggcggtgtcc
aaacagaatgccttcttcgaggcccattcgacagcgaattgcccgattttgttatcgggc
ctaaatcgcatgcttcttgacctgaatccacgtagtcgtaaaccagattatgtgctaaat
atcaccaaatatgtaacctacaacagttggctgccgcgtcatacattggcggcaattaaa
atacttggcgctgtcactgtcctgcccaatgttgccggccaaatcctaaccatgtatgcc
cagggctcaaacgagaagcttgagatacgacaaggttttgttgaatgcctggaaatggat
tgcaatttgccaccatcacatgatgagctattggagcaattgaatctgattaatccatat
gagggggcagctcctccaacggaaagtgaaaatagcagcagtctggagacgaagaaacca
ttgcgcattgaattgcaaattaaagaggcaattgttgaactatttctattgaatctcaat
caaccgttgccgaattttgtatgcttccttttgggtatcgatgtgctgcgtgattttatg
gccaatgagaagcaacaattgggcattgagatgaattgtgcgtgtttaaattcattggta
ttggcacaggaaaagtatttagagaaacaacgaaatgttgatgaatattgtgaacataca
gcccatttggtggaacgtatatataatctactttatggcctatgtgccaatcgtcgtaca
tcggagacaattttacgctatttccgcttgtcatgtaatgacttccttttacgtcatttg
aactcaatgcccttccgtcatcccagagaagaacatattctgcatgccatgagccatcta
ctcaattgtgttgcaattgaaatcaaattggctgccgtccatggccagacgacacgctat
aatctactctgtgacattctactggccagcaatccggatccacagcaacgaaatatccac
tcattgcccttggaattaacccaaccgacatcgaatttctatggcgtcgatggcacttgc
gtgggcgatggtgccattaatttgaccctaatgcaagagcatgccctgggtttgcatgcg
aatcgtatgctggattgtctaacattcgattcccatgcattaagccagccgcgtttggaa
ttctttgatagtcggctgatatcacaggttctcaaggattgcgaggcaccaaatgcaagt
gccgcagctgtttctgctgcctgttctggtggcggtagtcagggatcgaccagtttaatc
aacatacgtaaattacatgacatactgcacgatgaattgcgcatggtacagagcaccata
gccagtggccagcgcaaggcaatcactgtagagatagccactctattgcagcatggcata
gagatcaatcgcatacggacacatcgttgggctacattaaactttatgaacgcctggtgt
caggtggttcagattctatttagcagcatgcccgaagctgtgctacagattgctgtgcga
cgtcagtatatcatcgatatcattgagaagattctaatgaaggtgcaaccgatgcaaccg
ttaatcgagatttcgatacagataaccgaaacggttttactcttattggccaatctgcgt
tattgctgtcatctaatggaggatcagggcatgctggatgatcagaacagagatcagaca
actgattcaaatggtggtgcttcaattgctcctgatcatggtggtggtggtggtggtggt
ggtagtgtcgatggtgtgttcatggccaagatggccaaaaaatcaccgatttttggtaat
aataatggcagcaataataatatacgtttcattttgaaaaaacttgtcgaatggataatg
gttagcgaagtgaaatcacagaaattgcgcatcaatctctatagtgctctactcaattgt
ctgcgcattgtgaaacgtttgcgtagcgatgatcatttgggttatcatgaaaatttggtt
tcccgtttggatagctcaaggggttataatcatttacaacttggcgatgagttgatgcaa
caaaaggaaatggctgccgaagtgattggagcatttggtgaaaaactaattgatacaatt
tgccatgatgctgttacaggacatgatatatgccgtatgttggcattggcatgcctcgat
atgatatctgaattgaatgcggttagcacgttgagtgaattcattacggtgcgtggctat
ctgaagaatatactcgatagcctggctaaatcgacagaggatttgtgtggaatactccaa
ccggtgcccgataatctgcgtgccctgtatgtctatgagtcgcgtatgtcgttccttacg
cgcatcgcccagacaagtgtcggtgcacatttgctgctgggcgaacgggtattgggtgtg
ctatcgaatatgagggtatatgatatgcaacccgatctcaaggccagcgaattgaaaaga
aatttccccaaagaattcttacccaatattgatgaacgtttccgtgctatattattgcca
gcattggcattatgtgatgccattatgaattcattgggatcgacaaatatgtcggcatcg
ttgcagatattgaattttctattcgcccacattgatatggttgaggcaatgctgcgctct
gcaacaccattcatggatttatgccacctgcagcaattggcggcgataacgaatctattt
gcacgtaccacaacgcacgatgtgaccacattggaggatggtctggatgtacaaaacgat
atggaactgaggtgtcgtttgagttgtctgcaacaattgatgattgtggtttttggtaga
ttcacggttagtgaacaaagtatacgacaaatgataaatcaacagcaacaacaccatcat
cagcatcatcatcatctgcatgaatatgagtatgatgaaagtcaacagagtttacatatc
aaatactttttggatattgctgccaatctatccttatattgtcgcaatgctgtaacaagt
catgaaaaggatggcatgacatccaaatatcttttaaccacaatgatcaacgatataaca
ccattaactggcaaatcagatggcaagaaactaactgccattatgcataccatattgaat
caactgaaaggatccattggctattatctatcacagaaatccattgccgataatctattg
caacagagagcatcgttacccaacattacatttggaccaaatggcaaacaaagttatttg
gaacttagccagcgacacaatgagaaacgcagtgaactgatgcaagccgtttttatagcc
gaacaaaatttgtatttactttggatacatttagacttttatttacgcaatgccgtattg
tatatccaagagaatcgtaatgccattaacgagagcaatttggatccaacaaatctatct
gtactatatgcctcgcaggatgaagttcttcaattgaaacaattgctcatctccacattc
aacgaaacattctgcactcagctgatcaatgccagcgaagaatatacggtcaagtgtaag
gggttcaatgcctcacttttgcgtcgtattaaggcgctggtgcaatttgctccagtgcag
gagcaggccacaatattatatagaaaatga

DBGET integrated database retrieval system