KEGG   Drosophila willistoni: Dwil_GK16296Help
Entry
Dwil_GK16296      CDS       T01067                                 

Definition
GK16296 gene product from transcript GK16296-RA
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
dwi  Drosophila willistoni
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dwil_GK16296
   04150 mTOR signaling pathway
    Dwil_GK16296
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    Dwil_GK16296
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dwil_GK16296
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   Dwil_GK16296
Mitochondrial biogenesis [BR:dwi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    Dwil_GK16296
  Mitophagy factors
   Other mitophagy factors
    Dwil_GK16296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 592 aa AA seqDB search
MPQVRTAAAEAAAAAAGSGANGQPLVKIGHYLLGATLGTGTFGKVKVGEHQITRLKVAVK
ILNRQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYI
VKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMML
DGEFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRK
IKSGIFPIPEYLNKQVVNLVCQMLQVDPLKRATIEEIKKHEWFQKDLPAYLFPSSIEQDS
NVIDTYAVAEVCTKFGVKESEVHNSLLSGDPHDQLAIAYHLIIDNKRFADDAANQITEIN
NFFVAGSPPPPPPPSTLSSSHSPNERDVTVIVGGSGGTAVSSGSATPVPANGASATTNSS
TVMPGIRPHPERIAPMRERQLAMSVQNSGGAAFPEKTARGGTPIKRAKWHLGIRSQSKPN
DIMLEVYRAMKALNYEWKIINPYHVRVRRQNVKTSKFSKMSLQLYQVDAKSYLLDFKSLT
NDEVEQGDDVIMESLTPPTHSASAGTMPLQPTGHHTMEFFEMCAALIIQLAR
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgccacaggtaaggactgctgccgctgaggcagcagcagcggctgccgggagtggtgcc
aatggtcaaccgcttgtgaagattgggcattaccttcttggcgccacattgggtacaggc
acatttggcaaagtgaaggtcggtgaacatcaaataacacgccttaaggtcgccgtaaag
atccttaataggcaaaaaatcaaaagtttggatgtcgtgggcaagatacgacgggagata
caaaaccttaaactctttcggcatccccacataataaaattgtaccaggtgatttccaca
ccttcagatatatttatgattatggagtatgtgagcggcggagaactcttcgattatatt
gtcaaacatggaaaattgcaggagcatcaggcccgccggtttttccaacagatcatttcc
ggggtggattattgtcatcgccatatgattgttcatcgagatttgaagcccgagaacttg
ctgctcgatcataatatgcacgtaaaaatagccgatttcggtttatccaatatgatgctc
gatggcgaatttcttcgcacttcttgtggatcacccaattatgctgcacccgaggtgatt
tcgggaaaactgtatgctggtccagaggtggatatatggtcctgtggtgtcattctgtat
gccctcctgtgtggaacccttccctttgatgatgagcacgtgcccacactcttccgcaag
ataaaatctggcatattccccatacccgagtatctcaataagcaggtggtaaatttggtg
tgtcaaatgcttcaggtggatcctttgaagcgagccaccattgaagagattaagaagcat
gaatggttccaaaaggacttgccggcgtatttatttccctcttcgatagaacaggattct
aatgtgattgacacgtatgccgttgccgaggtgtgtaccaaattcggagtaaaagaatcg
gaagtccataattctttgctaagtggcgatccgcatgatcagctggcaatagcctaccat
ttgataattgataacaaacgatttgctgatgatgctgccaatcagattactgagatcaat
aatttctttgtggctggatcgcctccacctcctccacccccatccactttgtcatcaagt
cattcgccaaatgagcgcgatgttactgtcatagtcggaggaagtgggggtacggcagtc
agttccggctcagccacgccagtgccggcgaatggagcttcagctactactaatagctca
acggtcatgcccggcattcgtccacatcccgaacggatcgctcctatgcgtgaacgtcaa
ttggcaatgtcggttcaaaactctggaggggctgctttccccgagaaaacagcacgtggt
ggcacacctatcaaacgagccaaatggcatctgggtattcgatcccaaagcaagcccaat
gacattatgcttgaggtatatcgggcaatgaaggctcttaactacgagtggaaaatcatt
aatccgtaccatgtgcgcgttcgtcgtcaaaatgtcaagactagcaaattctcaaaaatg
tccctacaactgtatcaggtggacgccaaaagctatttgctagacttcaagtccctgacc
aacgatgaagttgagcaaggcgatgatgttatcatggagagcttaactccaccgacccac
agcgcgtctgctggaacgatgccgctccagcccacgggtcatcacacaatggagttcttt
gagatgtgtgcggcattaattattcagttggctcgctaa

DBGET integrated database retrieval system