KEGG   Drosophila willistoni: Dwil_GK16388Help
Entry
Dwil_GK16388      CDS       T01067                                 

Definition
GK16388 gene product from transcript GK16388-RA
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dwi  Drosophila willistoni
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dwil_GK16388
   03008 Ribosome biogenesis in eukaryotes
    Dwil_GK16388
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     Dwil_GK16388
Ribosome biogenesis [BR:dwi03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     Dwil_GK16388
Transfer RNA biogenesis [BR:dwi03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    Dwil_GK16388
Mitochondrial biogenesis [BR:dwi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    Dwil_GK16388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 195 aa AA seqDB search
MDNNNKPNNRHNRGRGQQNTNSNQRFRVVRKVPPRASNDNENRNNIYITSKTDIKAQQKR
CEDILNSGAKEIYIHCMGYSIIRGLNLALQIVENSEGALSYVIHTSTIRLVDELHPLCDD
EDISFRQRNNSALHIKIYNSSLFDIVVPKLPAQPALPAGTDDKEVPPSQPRKKTKKHKPH
QHNQQQQQQQQQSQK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggacaacaacaacaaaccaaacaatagacacaaccgtggtcgtggccaacagaacaca
aattccaatcaacgatttcgtgtggtacgcaaggtgcctccgcgtgcgtccaacgacaac
gaaaaccgcaataacatttacattactagcaaaacagacataaaggcccagcaaaagcga
tgtgaggatattctcaattctggagctaaggaaatctatatacattgcatgggatactcc
ataattcgtggtcttaatttagctctgcaaattgttgaaaattccgagggagcacttagc
tacgtgatacatacatccaccatacgtctggtggatgaattgcatccattgtgtgatgat
gaggacataagttttcgccagcgtaacaattccgccttgcacattaaaatttacaatagc
agcttgttcgatattgtggttcctaaactgccggctcaacctgctctgccagccgggacc
gacgacaaggaagtgccaccatcccagccgagaaagaagacaaagaagcataaaccacac
caacataatcaacaacaacaacagcagcagcagcagtcacagaaataa

DBGET integrated database retrieval system