KEGG   Drosophila willistoni: Dwil_GK16398Help
Entry
Dwil_GK16398      CDS       T01067                                 

Definition
GK16398 gene product from transcript GK16398-RA
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
dwi  Drosophila willistoni
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dwil_GK16398
Enzymes [BR:dwi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     Dwil_GK16398
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     Dwil_GK16398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 447 aa AA seqDB search
MATKASATTTTTTAVSTTSTTTTPTSIDGYKLGKVLIEGKTKQVYDLPEHPGLCLLLSKD
RITAGDGVKAHDLAGKAEISNTTNGQVFRLLNEAGIRTAYVKHCGAKSFIARKCEMIPIE
WVTRRLATGSFLKRNAGVPEGYRFSPPKQETFFKDDANHDPQWSDEQIISAKFELNGLLI
GQDEVDIMRRTTLLVFEVLERAWQTKNCALIDMKVEYGIDADGNIVLADIIDSDSWRLWP
SGDKRLMVDKQVYRNLTSVTSSDLDTVKRNFIWVSEQLADIVPKKDHLVVILMGSASDTS
HSEKIATSCRSLGLNVELRVSSAHKGPEETLRIVREYESVMNNIIFVAVAGRSNGLGPVV
SGSTNYPVINCPPVKSDNMQVDAWSSLNLPSGLGCATVLYPEAAALHAATILGLGNFMIW
SKLRVKQLNNFITLKKADKELRGVRNA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaaagcatcagccaccaccactacgacgacggccgtttccaccactagcacc
accacaacacccacatccatcgatggctataagctgggcaaagttctgattgagggcaaa
acgaagcaggtctacgatttgcccgaacatcctggcttatgtctattattgagcaaggat
cggatcactgccggcgatggtgtcaaggctcatgatctggccggcaaggcagagatatcg
aataccacaaatggtcaggtatttcgcctgctcaatgaggcgggcatcaggacggcgtat
gtaaagcattgcggtgccaaatccttcattgcccgcaaatgtgagatgatacccattgag
tgggtgacccgtcgtttggccactggttcattccttaaacgtaatgccggcgtaccggag
ggctacagattttcaccacccaagcaggagaccttctttaaggacgatgccaatcatgat
ccacaatggagcgatgagcaaatcatatcagccaaatttgagctaaatggcctgctaatt
ggtcaagatgaagtggatattatgcgtcgcaccacattgctggtattcgaggtcctggaa
cgtgcctggcagaccaagaactgtgctcttatcgacatgaaggtggaatatggcatcgat
gctgatggtaacattgttctggccgatatcattgattcggattcgtggcgcctgtggcca
tctggtgataaacgtctcatggtagacaaacaggtctatcgcaatcttacctctgtgacc
agcagcgatctggatacggtgaagcgtaatttcatttgggtatccgaacaattggctgat
attgtgccaaaaaaggaccatctggtggtcatattgatgggcagtgcttcggacacatcg
catagtgagaaaattgccaccagttgccgttccctgggactgaatgtagagctacgtgta
agctctgcccataaaggacccgaggagacgttaagaattgtccgtgaatacgaatcggtg
atgaataacatcatatttgtggccgtagctggacgttcgaatggtttgggtcctgttgtg
tccggtagcaccaattatccggttattaattgcccgcccgtcaagtcggacaacatgcag
gtggatgcttggtccagtttgaatctgccctcgggtctgggatgtgccaccgttctttat
ccagaggcagctgcattgcatgccgctaccattttgggtctgggcaactttatgatttgg
tccaaattgcgtgtgaagcaattgaataactttattactctcaagaaggctgacaaggag
ctacgtggagtgcgcaatgcctaa

DBGET integrated database retrieval system