KEGG   Drosophila willistoni: Dwil_GK16418Help
Entry
Dwil_GK16418      CDS       T01067                                 

Definition
(RefSeq) GK16418 gene product from transcript GK16418-RC
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dwil_GK16418
Peptidases [BR:dwi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dwil_GK16418
Ubiquitin system [BR:dwi04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dwil_GK16418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 604 aa AA seqDB search
MIHLRMADMESGHNNNKTEDNANDVSTTATVTLDRPRSSRYSHLYSNNSEASSSDTQPAA
ATSSSSSTRRSGKYTISSSNSSGDVPTATFTLRSNRTRRSNVEATPPPTAATPPPPPPPP
PPPPPITNGRSYENGTSLETKLNGLSLATNASKRNAIYDTTDDAGIGIGIGKTEGAASNE
LEADSTNGGDVSTTATLKLAKDSNGSKARNITSSSSSTRNILPPVSPTSSRYWDRDRDST
ATTNGRLSSSSSKYSSNNDDGIKSSSARDEKSDGLCGLRNIGNTCFMNSVIQCLSHTTEL
TRFLRTHHGSRSSSATKDQQILHEFAKLIQEMWTTNVHTVTPMELKRAFSTKHRMYSDFN
QQDAQEFLRFFLDSLHSALNTGVKGGEALNIDDNLSDNKKADLTWDWYTRHENSLVRDLF
VGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPPSSSRCKLDACLDLFIREEVLDGDEMPTC
SKCKTRRKCKKSFTIQRFPKYLVIHLKRFSETRWSKLLNVVEFPTSDRELNMGSYGSNSN
SSVHYSLYAISNHMGSTAGGHYVALCKHPDSRKWHEFNDNIVSDTLSENFLVSASAYILF
YERA
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgatacacctacgtatggccgatatggaatcgggtcacaataataataagacggaggat
aatgccaatgatgtcagcactacggcgacagtgacactggatagacccagaagtagtcgc
tatagtcatctatatagtaataactctgaagccagcagcagcgatacacaacccgccgcc
gcaacatcctcctccagttccacacgtcgctctggcaaatatacaatcagctcaagcaat
agcagtggagatgtccccacagcgacatttaccctaagaagtaatcgaacaagacgcagt
aatgtggaggcgacaccacctccaacagcagcaacgcctccacctccaccaccaccaccg
ccgccgccgccacccatcacaaatggtcgtagttatgagaatggaacatcacttgaaacg
aaactcaatgggttatcccttgcaacgaatgcatcgaaacgaaatgctatatatgataca
accgatgatgctggaatcggaattggaattggaaaaactgagggagcggccagcaatgaa
ttggaggcggattcaactaatggtggcgatgttagcacaactgccactttgaagttggca
aaggatagcaatggcagcaaggcgcgcaatataactagcagcagcagcagcacccgcaac
attttaccccccgtttcacccacttcaagccgctactgggacagggatcgggatagcacc
gccaccaccaatggccgtctatcatcatcatctagcaaatatagtagtaacaatgatgat
ggcatcaaaagttcgagtgcacgcgatgagaaatccgacggtctttgtggtctgagaaat
attggaaatacttgtttcatgaactcggtcatacaatgtctgagtcatacgactgagctg
acgcgcttcctacgtacacatcatggctcacgttcatcatcggccaccaaagatcagcaa
atattacatgaatttgcaaaactaatacaggaaatgtggacgacaaatgtgcataccgta
acccccatggagctgaagcgtgccttttccacaaagcatcgtatgtacagtgattttaat
caacaggatgcgcaggaatttctacgcttctttttggactcactgcactctgcattgaat
acgggcgtaaagggcggcgaagcgctaaacattgatgataatctcagcgacaataagaag
gccgatctaacctgggattggtataccaggcatgagaattctcttgtacgcgaccttttt
gtgggccaattgaagagtacattgaaatgtaccacttgtggtaataccagcgttacgttc
gatccattttgggatcttagcgtacccctgcccccctcatcatcgcgctgtaaattggat
gcctgcttggatctattcatacgagaagaagtcctcgatggcgatgagatgcccacttgc
tccaaatgtaaaacgcgtagaaaatgcaagaaaagtttcacaattcaacgttttcccaaa
tatttggttatacatttgaaacgtttctcggagacccgctggagcaagctattgaatgtt
gttgagtttccaacatcagatcgtgagcttaacatgggctcctacggatccaactcgaat
tcgagtgtgcattactcgctctatgcgatatccaatcatatgggctcgacggcaggcggc
cattatgtggctctatgcaaacatccagattcacgcaaatggcatgagtttaatgataat
attgtaagcgatactttatctgaaaacttccttgtttcggccagtgcttatatacttttc
tacgaacgtgcgtaa

DBGET integrated database retrieval system