KEGG   Drosophila willistoni: Dwil_GK16510Help
Entry
Dwil_GK16510      CDS       T01067                                 

Definition
GK16510 gene product from transcript GK16510-RA
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dwi  Drosophila willistoni
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dwi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dwi00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 349 aa AA seqDB search
MLCTRNLATRCLRRVHSSSSTGLVEPEHSLGIIGVPFAKGQSKQGVELAPDLLRQSNLRQ
VLQAAHDRLVIKDYGNLQYAVDENLLQQQRVHYHHIRNYADFMACNRALIGQVKQMLQQN
SQFLAIGGDHAIGFGSVAGHLQHTPNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLLEQ
LRSTWQHAELDEIAPNCLPKDQLVYIGLRDIDPYEAFILNKFGIRYYAMDAIDRLGVPKV
IEMTLDALNPQNKIHVSFDIDALDSNVAPSTGTAVRGGLTLREGISIVEALRDTKRVQGV
DLVEINPKLGNDRDVRTTVESGLEILKSMFGYRRSGHWGNIDTGILGRE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtacacgtaacttggccaccagatgcctacgaagggtccacagctccagctca
actggcctcgtcgagccggagcacagtttgggcattattggtgtgccctttgccaagggt
caatcgaaacagggcgttgaattggctccagatttgctgcgtcaaagtaatctacgtcag
gtgctacaggctgctcacgatcgcttggtgatcaaagactatggcaatctgcaatatgct
gtagatgagaacctgctgcaacagcagcgtgtccactatcatcacatacggaactatgct
gactttatggcctgcaatcgagccctaattggtcaggtgaaacagatgctccagcagaac
tcacaattccttgcgattggcggggatcatgccattggtttcggatctgtggccggtcat
ttgcagcatacaccgaatttgtcattggtttggatcgatgcccatgcggatatcaatttg
catagcacctcacagtcgggcaacatacacggaatgccagtttcgtttctattggaacaa
ttgcgatcgacatggcagcatgcggaactcgatgagatagccccaaattgtttgccaaag
gatcaattggtttacattggcttgagggacattgacccctatgaagcgttcatattgaat
aaatttggtatacgctactatgccatggatgccatcgatagactgggtgtgcccaaggtg
attgaaatgacattggatgcccttaatccgcaaaataagattcatgttagcttcgacatt
gatgccctggatagcaatgtggcccccagcacagggacagctgtacgtggtggacttacc
ctacgggaaggcatcagcattgtggaggcgctgagagacacgaaacgggtgcagggagtc
gatttggttgagatcaatcccaagctcggcaatgaccgggatgtgcgcactactgttgag
tccggacttgagatactgaagagtatgtttggctatcggcgatcgggtcattggggcaac
attgatacgggcatattgggtagggagtaa

DBGET integrated database retrieval system