KEGG   Drosophila willistoni: Dwil_GK16595Help
Entry
Dwil_GK16595      CDS       T01067                                 

Definition
GK16595 gene product from transcript GK16595-RA
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dwi  Drosophila willistoni
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dwil_GK16595
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dwil_GK16595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 531 aa AA seqDB search
MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAD
EMTKFHSDEYVRFLRSIRPDNMTEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAV
KLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDG
VEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDEAYESIFV
PIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGG
YTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKI
KNRLFENLRMLPHAPGVQIQAIPEDAINDESEDDDKVDKDERLPQSDKDKRIVPENEYSD
SEDEGEGGRRDNRSYKGQRKRPRLDKDNNSSNKTSSETSSEVKDDKDKADAAEGEDSPGS
NNNSTSQNSSAGGGNSTSNNNKTGDNDSSATGGAAAGGNSSSTKGAKENNI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctcatagcaaaaaacgcgtttgttactattatgacagtgatattggcaactac
tattatggccagggacaccccatgaagccccatcgcatacgtatgactcataatttgctt
ttaaattatggtctatatagaaaaatggagatttaccgccctcataaggccaccgccgat
gagatgaccaaattccattcagatgagtatgtacgattcctacgttccatacgtcccgat
aatatgacggaatacaacaagcaaatgcaacgtttcaatgtgggtgaggattgccccgtt
ttcgatggactgtatgagttctgtcagctttcggctggtggatcggtggcagctgctgtc
aaactgaataagcaggcctctgagatttgtatcaactggggtggaggactccatcatgcc
aaaaagtcggaggcatctggcttttgctatgtaaacgatatcgtcttgggtatattggag
ctactaaagtaccatcaacgcgtcctctatatcgacatcgacgtccaccatggcgacggg
gtggaggaggccttttacaccacggatcgtgtgatgacagtcagtttccacaagtatgga
gaatatttccctggaaccggggacctacgcgacattggtgccggcaagggaaagtactat
gccgtgaatatacctctaagggatggcatggacgacgaggcctacgagagtattttcgtg
cctattatatcgaaggtaatggagactttccaaccagccgcggtcgttttacagtgtggc
gccgactcgctgactggagatcgtttgggatgctttaatctcactgtaaagggtcatggc
aagtgcgtggagttcgtaaagaagtacaatttacccttcctaatggtcggtggcggtggc
tacaccatacgcaacgtgtcccgctgctggacctatgaaacatccgttgctctggctgtg
gaaatagccaatgaattgccgtacaacgattactttgagtactttggtcccgacttcaaa
ttgcacatcagtcctagtaatatgactaaccagaatacctccgagtatctggagaagatc
aagaatcgtctgttcgagaatctacgtatgctgccacatgctccaggcgtccagattcaa
gcgatacctgaagatgccatcaacgatgagtccgaggatgacgacaaggtcgacaaggat
gagcgtttgccgcagagtgacaaagacaagcgcattgttccagagaatgagtactctgac
tcggaagacgagggggagggcggacgacgcgataatcgctcgtacaagggtcaaaggaaa
cggccaagactggacaaggataacaatagcagtaataaaacctcgtcggagacctccagt
gaagtcaaagacgacaaggataaggctgatgcagccgaaggcgaggattcacctggctcg
aataacaattccacttctcagaacagcagcgcgggaggcggcaatagcacttccaacaat
aacaaaaccggcgacaacgattcatcagccacgggcggagctgcagctgggggcaactca
tcgagcactaagggcgccaaggagaacaacatatga

DBGET integrated database retrieval system