KEGG   Drosophila willistoni: Dwil_GK16620Help
Entry
Dwil_GK16620      CDS       T01067                                 

Definition
GK16620 gene product from transcript GK16620-RA
Orthology
K05635  
laminin, gamma 1
Organism
dwi  Drosophila willistoni
Pathway
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:dwi04512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1645 aa AA seqDB search
MKPSKRSLGGSYSSSSLCFQLPTALLLLTCWTSFTLAVQRQPINSAGGHELRGTTFMPAL
ECYDPYGRPQKCLPEFINAAYQLQIESTNTCGELGDNHFCIQTMNPNHKNCEFCRYEDHN
PLFLTDLHDPQNPTWWQSETMFEGIQHPNHVNLTLHLRKSYDITYVRILFRSPRPESFTI
YKRTSENGAWIPYQYYSATCRDTYSLPDSRAIRKGEGEAHALCTSEYSDISPLRDGEIAF
STLEGRPSGINFERSLELQDWVTATDIRITLDRLNTFGDELFGDSQVLKSYFYAISDIAV
GARCKCNGHASKCVASTGMHGERTLVCECRHNTDGPDCDRCLPLYNDVKWKRATSTEVNE
CKACNCNGLADKCYFDSHLFNLTGHGGHCLDCRENRDGPNCERCKENFYMREDGYCINCA
CDPVGSRSLQCNSHGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQPCGCDGRGSQDNTPAC
DAESGICFCKENVEGRRCNECKPGFFNLDKSNRFGCTPCFCYGHTSECQTAPGYSVVAVT
SNFNKHKERWTAIDLNRRDVDIKYNQYSRSIGTTAQGNEYVYFQAPDRFLGDQRASYNRD
LKFKLQLVGQVGPSTSASDVILEGAGSKISLPIFAQNNGIPDQGVKEYTFRLHEHHDYRW
QPSQSARGFLSILSNLTAIKIRATYSVQGEAILDDVELQTAHRGAAGQPATWIEQCTCPE
GYLGQFCESCAPGYRHSPARGGPFMPCIPCDCHGHADICDSETGRCICQHNTFGDNCDQC
AKGYYGNALGGTPYDCKRCPCPNDGACLQINGDTVICTECPVGYFGSRCEQCSDGFYGDP
TGLLGFVQTCKSCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLPGHFGDPLAL
PHGKCDRCSCYAAGTEQDEQSISKCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGNGCE
NCLCDPVGSYNATCDRYSGQCHCKPGVVGLRCDQCANYFYGFSPEGCKSCDCDESGSKGF
QCDQNGQCPCNDNVEGRRCDRCKENKYDRHRGCVDCPDCYNLVQDAANLHRAKLANLSAT
LDEIARTPVTNDEEFEAKLKAVQEKVALLAEDARDNSGESGQTYVEVIDDLHKRLDSMRN
HLESADKLQQDANEEIAKARRNYTELHSIIEDAKRELQEAIDLLNEEGSQALAKAKNKSE
EFGQQSQQISDISREARALADRLESEAQFDLQNAKDAKDAVEKALLLAKNAIDLQQKVSV
ELKSEVRLELNQVKQSLGAVAQTSKEALRKANEVYDAALTLLNDVNRQTQPDIDINQLKK
DAVAANEKADELLKQINELTNNNGEIYADFENEQKLGTLLLERAAKQKQDDIELLERAKA
AFEKATKAVKQGDNTLKEANNTYNTLAGFQSDVEASKEKADQALQTVPSIEQEIQNAKHL
ISQADEALDGANKNANEAKENAQEAQKKYAEQASKDAELIRRKANETKVAARNLRYEADQ
LTYRFGLTENDIFKLEENSTKDDNLVDDAKRKVGQAKADTQEAQKQIEKVNADLTAIKDE
LENLKDINTADLDKLENRLAIVENDIIRVNLTGRIEKYREQRNAQKKLIDKYELELTELI
HEVDNIRLISDALPDGCFRRNRLEP
NT seq 4938 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctagcaagaggagtctaggcggctcctactcctcctcctccttgtgtttccaa
ctgccaactgccctcttgctgttaacctgttggacatcattcacattggcagttcagcga
cagcccatcaattcagcgggtggacatgagttgaggggaaccacatttatgccggctttg
gaatgctacgatccctacggcagaccgcagaaatgtttaccagaattcatcaatgctgcc
tatcaattgcaaattgaatcgaccaacacttgcggcgaattgggcgacaaccatttctgc
atacagaccatgaatcccaatcacaagaattgtgaattctgcagatacgaagatcacaat
cctttattcctgacggatctgcatgatccacagaatcccacttggtggcaatcggaaaca
atgttcgaaggcattcagcatccgaatcatgtaaatttgacattacatttgcgcaaatcg
tatgacataacctatgtgcgcattttgttccgctcaccgcgtcccgaatcgtttaccatc
tacaagcgaacatcggagaatggcgcttggattccgtatcaatattatagtgccacctgt
cgggatacgtattcgttgcccgactctcgggccatccgtaagggcgagggtgaggcacat
gctctctgtaccagcgagtacagtgatatctcgccgttgcgcgacggtgagattgccttc
tccacgctggagggtcgtcccagtggtatcaacttcgagcgtagcctcgaactacaggat
tgggtcactgccaccgatatacgcatcacattggatcgcctgaatacgtttggtgacgag
ctctttggtgattcgcaggtactcaaatcgtatttctatgccatcagtgacattgctgtg
ggtgcgcgttgcaagtgcaatggacatgccagcaaatgcgtggccagcaccgggatgcat
ggtgaacgcaccttagtctgcgagtgtcgtcataatacagatggaccggactgtgatcgc
tgtttgccgttgtacaatgacgtcaaatggaagagggctacctccaccgaggtgaatgag
tgcaaagcctgcaattgcaatggcttggcagacaaatgttactttgattcacatctcttc
aatttaaccggccatggtggtcactgtttggattgccgggagaaccgcgatggccccaac
tgtgaacgctgcaaggagaatttctatatgcgggaggatggctattgcatcaactgtgcc
tgcgaccccgtgggttcacgttccctgcaatgcaacagccatggcaaatgccaatgcaag
cctggagtgacgggcgataagtgtgatcgctgcgacaacaactactatcagtttggccca
catggttgccagccatgtggctgtgatggacgtggctctcaggataatacgccagcttgt
gacgcggagagcggcatttgcttctgcaaggagaatgtcgagggcagacgatgcaatgaa
tgtaaaccgggcttcttcaatttggacaaatctaatcgtttcggctgcacaccctgcttc
tgttatggtcatacctctgagtgtcagactgctcctggttattcggttgttgccgtcacc
tcgaacttcaataagcacaaggaacgctggacagcgatcgatttaaatcgtcgtgatgtc
gatatcaaatacaatcaatatagccgtagtataggcaccacagcccagggcaatgaatat
gtctacttccaggcgcccgatcgtttcttgggcgatcagcgtgcctcctataatcgggac
ttgaaattcaaattgcaactggtcggtcaggtgggaccgagcacaagtgccagtgatgtt
atactcgagggagccggcagtaaaatctctttgcccatatttgcccagaacaatggcatc
ccagatcagggagtcaaggagtatacgttccgtttgcatgagcatcatgactacagatgg
cagccaagtcaatccgcacggggattcctttcgattctatcgaatttgacagccatcaag
atacgtgccacctactcggtgcagggtgaggctatattggatgacgtggaattgcagacg
gcgcatcggggagcagctggtcagccggccacctggatagaacagtgtacctgcccagag
ggttatctcggtcaattctgcgagtcttgtgctccgggctatcgccatagtccggcgcgt
ggaggtcctttcatgccctgcatcccatgcgattgccatggacatgcggatatctgtgac
tcggagacaggtcgctgcatttgtcagcacaataccttcggggacaactgcgaccagtgt
gccaagggctactatggcaatgccttgggaggcactccctacgactgcaaacgctgccca
tgccccaatgatggcgcttgtctgcagataaatggcgacacggtaatctgtacggaatgt
ccagtgggttactttggctctcgttgtgaacagtgtagtgatggcttctatggcgacccc
accggactcttgggctttgtccagacctgcaaaagctgcgactgcaacggcaatgtcgac
ccgaatgccgtgggcaattgtaaccgcacgacgggcgagtgtctcaagtgtatccataat
acagccggtgagcattgtgatcaatgtttgcccggacactttggcgatccattggccttg
ccacatggcaaatgcgatcggtgtagctgttatgccgccggcacggagcaagatgaacaa
agcatttccaagtgtgatcaggtcactggccagtgtcaatgtaaaccgaatgttattgga
cgcgattgtggtgaatgccagccgggttatttcaatatacgttcgggcaatgggtgtgag
aactgcttgtgcgatcctgtgggcagttacaatgccacatgcgatcggtactccggccaa
tgccactgcaagcccggagtggtgggtctgcgttgcgatcagtgtgccaattatttctat
ggcttctcgccggaaggttgcaagtcttgtgactgcgatgagagcggctcgaagggattc
cagtgcgatcagaatggtcagtgtccgtgcaacgataatgtcgagggccgtcgctgcgat
cgatgcaaagagaataaatacgatcgacatcgcggctgcgtcgattgtccagactgttat
aatcttgtgcaggatgccgccaatcttcatagagccaaattggctaatctcagtgcgact
ctggatgagattgcccgcactccggtgaccaacgatgaggaattcgaggccaagttgaag
gcagtgcaagagaaagtcgcccttctggctgaggatgcgcgcgataattcgggcgagagt
ggccagacctatgtggaggtcattgatgatctgcataagcgtttggacagcatgcgtaat
catttggagagtgccgataagttgcagcaggatgccaatgaggagattgccaaggcacgt
cgcaattacaccgaactccatagcatcattgaggatgccaaacgggagctacaggaggcc
attgatctactgaacgaagagggatctcaagcactggccaaggccaagaataagtccgag
gaatttggtcagcaatcgcagcagatatcggacatctcgcgtgaggcacgtgccctggcc
gatcgcctcgaatcggaggcccaattcgacttgcaaaatgccaaagatgccaaggatgcc
gtcgagaaggccctcttgttagccaagaacgccatcgatctgcagcagaaggtcagtgtg
gaattgaagtccgaggtgcgtctcgagttgaaccaagtcaagcagtcattgggcgctgtg
gctcaaacctccaaggaggctctccgtaaggcgaatgaggtttacgatgccgctttgacc
cttctcaacgatgtcaatcgccagacccagcccgacattgacataaatcaattgaaaaag
gatgctgtggcagccaatgaaaaagccgacgaactacttaaacagataaacgagttgacc
aacaacaatggagaaatctatgccgattttgagaatgaacagaaattgggcacattgctg
ctggagagggccgcaaaacaaaaacaagatgacattgagctcttggagcgggccaaggca
gccttcgagaaggccaccaaggctgtaaaacagggtgataataccctaaaggaggccaac
aacacgtacaacactctggctggcttccagtcggatgtggaggcatccaaggagaaggct
gatcaggccctacaaacggttcccagcatcgagcaggaaattcaaaatgccaaacatctg
attagtcaggcggatgaggctctcgatggtgcaaataagaatgccaacgaagccaaggag
aatgcccaagaggcccagaagaaatatgctgaacaggcctcaaaggatgccgaactgata
cgtcgcaaggccaatgaaactaaggtggctgctcgtaatctacgctatgaggccgatcag
ctaacatatcgtttcggattaaccgaaaatgatatattcaaactggaggagaactctacc
aaagatgataatctggtcgatgatgccaagcgtaaagtgggacaggccaaggctgatacc
caagaggcccagaagcaaattgaaaaggtcaatgcggatctaactgccattaaggatgag
ttggagaatctaaaggatatcaatacagctgatttggataaactggaaaatcgtctggcc
attgtggagaatgatattattcgtgtcaatctaacgggtcgcattgaaaagtatcgagaa
caaagaaatgcgcagaagaaactgatcgataaatacgaattggagttaacggaacttata
cacgaagtggacaacatacgtttaatatccgatgcactgcccgatggctgcttcagacgt
aatcgcctagagccatga

DBGET integrated database retrieval system