KEGG   Drosophila willistoni: Dwil_GK16840Help
Entry
Dwil_GK16840      CDS       T01067                                 

Definition
GK16840 gene product from transcript GK16840-RA
Orthology
K06634  
cyclin H
Organism
dwi  Drosophila willistoni
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dwil_GK16840
  Replication and repair
   03420 Nucleotide excision repair
    Dwil_GK16840
Transcription machinery [BR:dwi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dwil_GK16840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 326 aa AA seqDB search
MYPVSSQKRSWTFANESQLASFRVEQNTKYIEQHEAEARANNCEVDDYFLTPAEERLLLK
RYEIHLADFCGRFDPPMPKCVVGTAFHYFKRFYLNNTPMDYHPKEILATCVFVACKIEEF
NVSINQFVNNIKGDRNKATDIVLSNELLLIGQLNFYLTIHNPFRPIEGFIIDIKTRSNMQ
NPERLRPHIDSFIDATFYTDACLLHTPSQIGLAAVLHAASKEQENLDSYVTELLFVAARD
KLPALIDAVRKIRIMVKQYQPPDRDQVKAIEKKLDRCRNQANNPVSELYKERLRRLYTDE
DDIPADDASFHIADVSSDTSAMNISQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtatccggttagctctcaaaagcgatcttggacatttgccaatgaatcccaattggcg
tcatttcgagttgagcagaataccaaatatatagaacagcatgaggccgaagctcgggcc
aataattgcgaagtcgatgattatttcctgacaccggcagaggaacgcctgttattaaag
cggtatgagatccatttggccgacttttgtggccgtttcgatccgcccatgccaaagtgt
gttgtaggaactgcatttcactatttcaagcgcttctatttgaacaacacaccgatggat
tatcatccaaaagagatattagctacttgcgtatttgtggcctgcaaaatagaagagttc
aatgtgtccattaatcagttcgtgaacaacatcaagggggatcgcaataaagccaccgat
atagtcttatcaaatgagctattgttaataggacaattgaacttctatttaaccattcac
aatccattccgccccatcgagggcttcataatagatattaaaacgcgtagcaatatgcaa
aatccggaacgtttgcgtccacatattgatagttttattgatgccacgttttatacggat
gcatgtctgttgcatactccgtcacagatcggtttggccgctgtactccatgcggcaagt
aaagaacaggagaatctcgatagctatgtcaccgaattactctttgtggcggcccgagac
aaactgcccgccctaatagacgctgttcgaaagattcgtattatggttaagcagtatcag
ccaccggacagggatcaagtcaaagctattgaaaagaagctggatagatgtcgcaaccag
gctaataaccccgttagtgaattatataaggaacgcctacgccgcctgtatacggatgag
gatgatatacccgccgacgatgcctcatttcacatagctgatgtgagctcggatacatca
gctatgaacataagtcaatag

DBGET integrated database retrieval system