KEGG   Drosophila willistoni: Dwil_GK16872Help
Entry
Dwil_GK16872      CDS       T01067                                 

Definition
GK16872 gene product from transcript GK16872-RA
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dwi  Drosophila willistoni
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dwil_GK16872
Enzymes [BR:dwi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dwil_GK16872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 275 aa AA seqDB search
MTSRPLRTVIIFKSESESTEIYAETLNAHNFQPIFIPTLSFGFKNLDELQRKLQNPDKYA
GIIFTSPRCVEAVSEALQLSELPGGWKLLHNYSVGEVTHNLALSTLQQLFTHGKQTGNAR
NLGDYIVDTFDGSRNLPMLLPCGNLATDTLLSKLAENGFSVDACEVYETKCNPQLGELLE
RALVQASDNIEYLAFFSPSGVNCVYEYFNTRQIPLDKWKLVAIGPSTRRAMEAMGMKVFC
TAERPTVEHLVKVLLNPQESRERLVRTAAATADAN
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtcgtccgctacgcacggtaattatattcaaatcggaatcggagagtaccgaa
atctatgctgaaacgctcaacgcgcacaatttccaaccgatctttatacccactctcagt
tttggtttcaagaatttggatgagctgcaacgaaagttgcagaatccggacaaatatgcc
ggaatcatatttacgagtccgcgctgcgtggaggccgtatcggaggcattacaattaagt
gaattgcctggcggatggaagctattgcataactattctgttggcgaggttacccataat
ctggcattgagcacattacaacagctgttcacccatggcaaacaaacgggcaatgcccgg
aatctgggtgactacattgtggacacattcgatggttcaagaaatttgccgatgctcttg
ccgtgcgggaacttggccacggacactttgctctcgaagctggcggagaatggcttcagc
gtcgatgcctgtgaggtgtatgaaacgaaatgtaatccccagttgggtgaacttctggaa
cgggccctagtccaggcatccgataatattgaatatttggcattcttctctccatcgggt
gtcaactgtgtctatgagtatttcaatacacgtcagataccgctggataaatggaaacta
gtggccattggcccaagtactaggcgagccatggaggcgatgggtatgaaagtgttttgc
actgccgaacgtcccactgtcgagcatttggttaaggtgctgctcaatcctcaagagagt
cgagagcgtctggtacgtacggcagcagcgactgcagatgccaattag

DBGET integrated database retrieval system