KEGG   Drosophila willistoni: Dwil_GK16976Help
Entry
Dwil_GK16976      CDS       T01067                                 

Definition
GK16976 gene product from transcript GK16976-RA
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dwi  Drosophila willistoni
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dwil_GK16976
Enzymes [BR:dwi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Dwil_GK16976
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dwil_GK16976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 328 aa AA seqDB search
MERKLHSGIHHPTLRLLQESGCEILPHNLMYPVFIVSHDDDVQPIASMPGISRFGINKLR
EHLEPLVPQGLKSVLLFGVVEGNLKDEMATHADSAENPVVRAIPKLRKWFPELLIACDVC
ICPYASHGHCGLLGETGLENGPSIKRIADIAVAYGKAGAHIVAPSDMMDNRVKAIKQALI
DANLNSVSLLAYSAKFASNFYGPFREAAQSAPKFGDRRCYQLPSGSRNLAMRAVQRDVSE
GADMLMVKPGMPYLDILRQTKDTYPYHTLYVYQVSGEYAMLYHAAQAGSFDLREAVLESM
KGFRRAGADCIITYYTPYLLNIIDNKSA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaaaattgcacagtggaatacatcatccaacgttgcgtttgctgcaggaatcc
ggatgtgaaatactgccacataatctaatgtatccggttttcattgtcagccatgatgac
gatgtgcagcccattgccagcatgccgggaatctcgcgatttggcattaacaaattacgt
gaacatctggagccattggtgccacagggattgaaatcagtgctgctctttggcgtcgtt
gagggcaatctcaaggacgagatggccacccatgccgattcggcggaaaatcccgtggtc
cgtgccatacccaaattacgcaaatggttccccgaacttttaattgcctgcgatgtgtgc
atctgtccgtatgcttcgcatggccattgcggcctgctgggtgagaccggtctggagaat
gggccgagtataaaacgtattgccgacatagctgtggcctatggcaaagcgggtgctcac
atagtcgccccctccgacatgatggacaatcgggtgaaggccattaagcaggcactgatc
gatgccaatttgaatagtgtctcgctattggcctattcggcgaaattcgcatcgaatttc
tatggaccattccgtgaggcagcacaaagtgctccgaaattcggcgatcgtcgttgctat
caattgcccagtggttcacgtaatctggcaatgcgtgccgtccagcgggatgttagcgag
ggtgccgatatgctaatggttaaacccggcatgccttatctggacatattgcggcagacc
aaggacacatatccatatcatactttgtatgtgtatcaggtatctggagagtatgccatg
ctatatcatgccgctcaagcgggttcctttgatttacgtgaagctgtcctagagtcaatg
aagggttttcgtcgagctggtgccgattgtattataacctactatacaccatatctgctc
aatatcatagacaacaaatcggcatga

DBGET integrated database retrieval system