KEGG   Drosophila willistoni: Dwil_GK16996Help
Entry
Dwil_GK16996      CDS       T01067                                 

Definition
GK16996 gene product from transcript GK16996-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dwi  Drosophila willistoni
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dwil_GK16996
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dwil_GK16996
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dwil_GK16996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 534 aa AA seqDB search
MRIFRLSPGDLFLPFPLPLLLLQLAVLSHCQYTYGPEQSWLIHSHSALRNKELWFHDAQR
TLYEKLSTPPNQYLAKNVIFFLGDGMSVPTVTASRIYDGQLRGIVGERNRLEFEKFNHVG
LSKTYCANKQVSDSACTASAYLSGIKANYLTIGVTADVQLNDCAGARLPQNRLSSIAAWA
LRGRKSAGLVTTTRVTHASPAGVYAHTSNRDFESDYDVHELGQNPSNCPDIAQQLIESDV
GQRLRVILGGGTKKFLPNTTTDIYGNQGQRLDGRNLINEWQLSKPGNARVVFNRTDLLNN
DPRTTDYLLGLFNASHLAYHLDDSIDTPTLAEMTEAALAVLSKDNNGYFLFVEGGRIDHA
HHETKAKKALDETVQFSDAIRKARQMTNPWETLIVVTADHGHTVTISGYPDVNNNITGLN
SELSDIDQLPYATLSYANGPDYQKFYTTNDSVVERVDLRTLDIGDKDARYPHGVPMSEET
HGGGDVAVYAHGPWSHLFTGVYEQSCLPSLMGFASCLGPGITYCDLQPKEFYNP
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatttttcggctatcgcccggtgatctgttcctaccgtttccactacccctcctc
ctgctccagttggccgttttaagccattgtcagtacacatatgggccagagcagagctgg
cttatacattctcacagtgcgcttaggaataaggaattatggttccatgatgcccaacgt
acactttacgagaagctatcaacgcccccaaatcaatatttggccaagaatgttatattc
tttctgggcgatggcatgtcagtgcccacggtaacagcaagtcggatatatgatggccaa
ctgcgaggcattgtgggtgaacgaaatcgcttggaatttgagaaatttaatcatgttggt
ctatcaaagacatattgtgccaacaaacaagtctccgattcggcatgcacagcttccgcc
tatttatcagggatcaaggccaattatttgaccattggtgtgaccgctgatgttcagttg
aatgattgtgctggagcaagattaccacagaatcgtttgtcatcgatagcagcttgggca
ttgcgtggccgtaaatcagctggtctggtgaccacaacacgagttactcatgccagtccg
gctggtgtgtatgctcatacctcaaatcgggatttcgagagtgattacgatgtccatgag
ttgggtcagaatccaagcaattgtccggatatagctcagcaattgatagagagtgatgtg
ggccaacgattgagagtaattctcggtggtggaactaaaaaattcttgcccaatactacg
acagatatttatggtaatcagggtcaacgattggatggacgaaatttaataaatgaatgg
cagttgagtaagccgggaaatgcccgagtagtgttcaatcgcacggatttgcttaacaat
gatccgaggacaaccgattatctgttaggtctattcaatgcatcgcatttggcatatcat
ttggacgatagcatagatacaccaacattggcggaaatgactgaagccgctttggcagtt
ctttcaaaggataacaatggctatttccttttcgtggagggcggacgaatcgatcatgcc
catcatgagaccaaggctaaaaaggctttagacgaaactgttcaattttcggatgccata
cgcaaggcacgtcaaatgaccaatccatgggaaacattgattgtggttactgctgatcat
ggacatacggttacaattagcggctatcctgatgtgaataataacattacaggactaaat
tccgagctgagtgatattgatcaattgccctatgccacgctctcgtatgccaatgggcca
gactatcagaaattctatacgactaatgatagtgtagtggaacgtgtggatttgcggaca
ttggatattggcgacaaggatgctcgctatcctcatggagtgcccatgtcagaggagacc
catggtggcggagatgtggctgtctatgcccatggaccctggtcacatttgtttactggt
gtgtatgagcaaagttgcttgccatccttaatgggtttcgcctcttgcctgggaccagga
ataacctattgtgatctgcagcccaaggaattttataatccctaa

DBGET integrated database retrieval system