KEGG   Drosophila willistoni: Dwil_GK17016Help
Entry
Dwil_GK17016      CDS       T01067                                 

Definition
GK17016 gene product from transcript GK17016-RA
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
dwi  Drosophila willistoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 678 aa AA seqDB search
MTIKPVSAPSAKRVSVSGNVVDAENKEPQVVVVGGEQSVVNQTHRNVVIDGHSQSPQRRN
VEVYDELARTHRCSPHKSSRSKRRDHHDERIHHHKRDRLEREKLTHSTAGVVSVGSKSPL
ATVTAAAVPAVVNTNGSPAAVGRTSPEHSIGANTSSKTQTKTQLTPTAAVANLLNAVEET
FSGYNSGDEHLQPKDRKITAEEWQRRDNEFAKFMEQRGYELKPVEEDGACLFRSISLQIY
GDEEMHDVIRQHTMDYIHENREYFGQFVTEDINNYIQRKRARDAHGNHIEIQAISEIYSR
TVEVYCYQANPINIFNSEQSQPGYPPLRLSYQRGSHYNAILDPYNATVGVGLGLAGYKPA
LQTKEAVHLSEQLEIEQTMFEDKLKTTDWEATNEAIEEQIARESYLQWCRDNMQRTRSSN
PAAGSATSTSTVTSAEALTDSSDASPSKYSGDSGSSPTASSSKGTDSTVSTAFGLSPKTL
NQFGHKLAPPPEAIELGSVGGGGSGANANGSSSGSSPGGAGGGYDSDATDMSSTSSLGHG
PGSASPNTATTNQRSSKSRRSNGSLRKKRRHEARDTTMAGQSQDVIETPVRKSPKCDAVP
PDARAQTPEADQQPCTSKQSSNSPPKRNDVPASSFYQELLEASYANDGVNESEMLQRAIQ
MSTRDYMEDQKRKYFTGP
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaagccagtgagtgcacccagtgccaaacgtgtctccgtcagtggcaatgtt
gtggatgctgaaaataaagagcctcaggtggtagttgttggtggtgagcaatcggttgtc
aatcagacacatcgcaatgtcgtcatcgatggccacagccagagtccacaacgtcgcaat
gtggaggtatatgacgaactggcacgcacacaccgttgcagtccacacaagagctcccgc
tcaaagcgtcgtgatcatcatgatgagcgcattcatcatcacaagcgtgatcgtttggaa
cgtgagaaattgacacattcaactgctggtgtcgttagtgtgggtagcaagagtcctctt
gctacagtgacggctgctgccgttccagctgtggtcaataccaacggtagccctgcggca
gtgggacgcacatcaccggagcattcgattggagctaataccagcagcaagacccaaacc
aagactcaattaacaccaacagcagctgtagccaatctacttaatgcggtggaggagacg
ttttccggttacaacagcggcgatgagcatctacaaccaaaggatcgcaagataacagca
gaggagtggcagcgacgtgacaatgagtttgccaagttcatggaacaacgaggatatgaa
ctaaagcccgtcgaagaggacggagcttgtctctttcgctctatttcgttgcagatctac
ggggatgaggaaatgcacgatgttatacgccagcacaccatggactatattcatgaaaat
cgtgaatatttcggacagtttgtcaccgaggacatcaacaattatattcagcgcaaacgt
gcccgggatgcccatggcaatcatattgaaattcaagccatatctgaaatctatagtcgc
actgttgaggtctattgctatcaggcgaatccgattaatatcttcaactcggaacagtca
cagccgggctatccaccgttgcgtctatcgtatcagcgtggctctcattacaatgcaatt
ttggatccatataatgccacagtgggtgtgggtctgggcttggctggttacaagcccgcc
ttgcagaccaaggaggcagtccatctcagtgagcagttggagatcgagcagacaatgttt
gaggacaagctaaagaccaccgattgggaagccaccaatgaggccatcgaggagcaaata
gcacgcgaatcctatttgcaatggtgtcgtgataatatgcagcgcactcgtagcagtaat
ccagccgccggttcggctacatcaacatcaacagtgacatcagctgaggcgttaaccgat
tcatcggatgcttcaccatccaaatactcgggtgactcgggcagttcaccgactgcttct
agctccaagggaaccgattcaacagtatccacagcatttgggctctcccccaagacgctg
aatcagtttggccacaagctggcgcccccaccagaggcaattgaattaggtagcgttggc
ggtggtggttctggagctaatgctaatggaagcagcagcggcagcagtcccggtggtgct
ggcggcggctatgacagcgatgcaacagacatgagcagcaccagttcacttggccatgga
cctggcagtgcctcgccaaatacagcaactacgaatcagcgttcgagcaaatcgcggcgt
tcgaatgggtcactgcgcaagaaacgacggcatgaggcccgcgacactacaatggccgga
caaagccaagatgtaatcgaaacacctgtgcgcaagagtcccaaatgcgatgctgtgcca
cctgatgctagggcccagacaccagaagccgatcagcagccctgtacatcgaagcaatca
tccaattcgccaccgaaacgaaacgatgttccagcttctagtttttaccaggaactgctt
gaagcctcctatgccaatgatggcgtcaatgagagtgagatgctccaacgggccatacaa
atgtccacacgggactatatggaggatcagaagcgaaagtatttcaccggaccataa

DBGET integrated database retrieval system