KEGG   Drosophila willistoni: Dwil_GK17132Help
Entry
Dwil_GK17132      CDS       T01067                                 

Definition
GK17132 gene product from transcript GK17132-RA
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dwi  Drosophila willistoni
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dwil_GK17132
   00052 Galactose metabolism
    Dwil_GK17132
Enzymes [BR:dwi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dwil_GK17132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 376 aa AA seqDB search
MAVTLKEEIFGLAINPLTNVPEMVRRYTLTNANQMSVSFIQLGAIIQSVRIPDVYKKVED
VCLGFDDIAGYVANKSAYIGGTLGRVANRVANGEFICNDTKVEVTKNFKDTYQLHGGFIG
FDSVIWEVVNKSDSGITFRHVSDDGDEGYPGKLTVLIHYTLDNQNRFGIRYEAATDKVTA
VNLSNHAYFNLAGHNTGRKGLAEHTVEIISSQIVDTDDAQIPTGQLLNVDETVFDLRLPV
LLGDRLLQFDKHLIKGYDNCFVLNEGNTVTNGTNLAAKLVHPPSGRVLEVWTDQPGLQFY
TANNLPDEEAGETPMIGKDCTHYVKHGSFCVETEKFPDAVNHSSFPSIVLKPDEKYKHEV
IYKFHVEESWKCCCNK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggccgttacattgaaggaggagatctttggcctggccataaatccattgacaaacgtc
cccgaaatggtgcgtcgctatacactgaccaatgcgaatcaaatgtccgtttcgtttata
caattgggcgccatcattcagagtgtacgcataccggatgtctataaaaaggttgaagat
gtctgtctaggattcgatgatatagccggatatgtggcaaataaatcggcatatattggc
gggacattgggtcgtgtggccaatcgggtggccaatggtgaattcatttgcaatgatacc
aaagttgaggtaacaaaaaatttcaaggatacctatcaattgcatggaggcttcattggt
ttcgatagtgtgatttgggaggtagtcaacaaatcagatagtggcattacctttcgtcat
gtctcggacgacggtgacgaaggttatcccggcaaattgacagttcttatacattataca
ctggataatcaaaatcgatttggcatacgctatgaagcggcaaccgataaagtgacggcc
gtaaatctatccaatcatgcgtatttcaatttggctggccacaatacaggacgcaaaggt
ttggccgagcatacagtggagataattagctcccagattgtcgacactgatgatgctcag
ataccaaccggtcagctcttgaatgtcgatgagactgtctttgatctacgtttgcctgtc
cttttgggtgatcgtttgctgcaattcgataagcatttaatcaaaggctatgacaattgt
tttgtcctcaatgagggtaatacggtgaccaacggtaccaatttggcagcgaaacttgtt
catccgcccagtggtcgtgttttagaggtttggactgatcaaccaggcctacaattttat
acggccaacaatctaccggatgaggaagctggcgaaacaccaatgattggcaaagattgt
acacactatgtaaaacatggttcattctgtgttgaaactgaaaaattccccgatgctgtc
aatcattcatcatttccatccatagtcctaaagccagatgagaaatataaacatgaggtc
atctataagttccatgtggaggaatcatggaaatgttgttgtaataagtag

DBGET integrated database retrieval system