KEGG   Drosophila willistoni: Dwil_GK17177Help
Entry
Dwil_GK17177      CDS       T01067                                 

Definition
(RefSeq) GK17177 gene product from transcript GK17177-RB (EC:3.-.-.-)
  KO
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
dwi  Drosophila willistoni
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dwil_GK17177
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dwil_GK17177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 221 aa AA seqDB search
MSAPVIIEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGF
RMPSWFDLKTLDISGPEDEPGIQAARDNVHGMIQKEVSAGIPANRIVIGGFSQGGALALY
SALTYDQPLAGVVALSCWLPLHKQFPGAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLL
KSFMKNVTFKTYNGLSHSSSDDEMDDVKDIISKWQQLNNHL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaccggtcattatcgaggccacggtcaagcagacggcaacgttgattttcatg
catggcctgggcgacactggacatggttggagcagtgcattggcagccattaggccgcca
ttcatgaaggtcatttgccccacggcgcccacacagcccgtttccttaaatgctggcttc
cgcatgccctcgtggttcgatctgaagactttggacatctctgggccagaggatgagccg
ggcatacaggcagcacgagacaatgttcacggtatgatccagaaggaggtgagcgcgggt
ataccagccaatcggattgtgattggtggcttctcccagggtggagcattggcattgtat
tcggcgctaacgtacgatcagccgctggccggcgtggtggctctatcctgttggcttccg
ctgcacaagcaattcccgggggccaaagtaaacagcgacgatgtgccgatcttccaggcg
catggcgactacgatcctgtggtgccttacaagtttggccagctaagtgcaagtttactc
aaatctttcatgaagaatgtcacctttaagacctacaatggactttcacactcgtcatca
gacgatgaaatggacgacgtaaaggacataatcagtaaatggcaacaattgaataatcat
ctataa

DBGET integrated database retrieval system