KEGG   Drosophila willistoni: Dwil_GK17198Help
Entry
Dwil_GK17198      CDS       T01067                                 

Definition
(RefSeq) GK17198 gene product from transcript GK17198-RA
  KO
K00012  
UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
dwi  Drosophila willistoni
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dwil_GK17198
   00053 Ascorbate and aldarate metabolism
    Dwil_GK17198
   00520 Amino sugar and nucleotide sugar metabolism
    Dwil_GK17198
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     Dwil_GK17198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 476 aa AA seqDB search
MKVCCIGAGYVGGPTCAVMALKCPDIVITLVDKSSERIAQWNSDKLPIYEPGLDEVVKKC
RNVNLFFSTDIETAIKDADLIFISVNTPTKISGNGKGRAADLKYVESAARMIAEIAQSNK
IVVEKSTVPVRAAESIMHILRANQKPGIHYDILSNPEFLAEGTAINDLLNADRVLIGGEE
TPEGHQAVEKLSWIYEHWIPKKHILTTNTWSSELSKLAANAFLAQRISSINSLSAVCEAT
GADVSEVARAVGLDSRIGSKFLQASVGFGGSCFQKDILNLIYICENLNLPEVAAYWQQVI
DMNDYQKRRFSQKIIESLFNTVSDKRIAILGFAFKKNTGDTRETAAITVCQTLLEEGAKL
DIYDPKVEPEQIIDDLTHPSVTESPENVKKAVQIHSDPYSAVRSTHALVVCTEWDEFVDL
DYTRIYQSMMKPAYIFDGRKILDHERLQQIGFHVQTIGKKYQRTGLLRSWGIVPQL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttgttgtattggcgctggttatgtgggcggtccaacatgtgcggtaatggca
ctcaaatgccccgatattgttataaccctggtggataaaagttccgagcggattgctcag
tggaattcggataaattgcctatttatgagcctggcctagatgaggtagtcaagaagtgc
cgaaatgtgaatctatttttctccaccgacattgagacggcgattaaagatgcagatctc
atctttatatcagtcaacacgccaacaaaaataagcggcaatggcaagggacgagctgct
gacctgaaatatgtggaaagtgcagcccgtatgattgccgaaattgctcaatcaaataaa
attgtcgtggagaagagtacagtgccagtgcgagctgccgaaagtattatgcatatattg
agggcaaatcaaaagcctggcatacattatgatatactatcgaatccggaattcttggcc
gaaggaacggctatcaatgatttacttaatgctgatcgtgttttaattggtggcgaagag
acaccggaaggacatcaggcggtagagaaactatcatggatctatgagcattggataccc
aagaagcatatattgacgaccaatacatggagtagtgaattgtccaaattggcggcaaat
gcatttctagcccaacgcatttccagtattaattccctatcggctgtgtgtgaagccacc
ggtgccgatgtctctgaggtggcacgtgccgttggtctggactcgagaattggttccaaa
tttctgcaagcatcggtgggctttggcggtagttgtttccaaaaggatatactcaatttg
atatacatttgcgagaatcttaatttgcccgaagtggcggcctattggcaacaggttatc
gatatgaatgactatcagaagcgacgtttctcgcaaaagataatcgagagtctgttcaat
acggtgtcggataaacgtattgccatattgggttttgcatttaagaagaatacgggcgat
acacgggaaacggcagcgattacggtgtgccaaacgttgctggaggagggtgccaaactg
gatatctatgatccgaaagtggagcccgagcaaataatcgatgatctaacgcatccaagt
gtaaccgaatcgccggagaatgtaaagaaggccgtacagattcacagtgatccgtatagt
gcggttcgatccacacatgccttggttgtgtgcaccgaatgggatgaatttgtggatttg
gattatacacgcatctatcagtcgatgatgaaaccagcatatatcttcgatggccgtaag
atccttgatcatgagcgtttgcagcaaattggtttccatgttcagacaattggcaaaaag
tatcagcgtacaggacttttacgatcctggggaattgtgccgcagctgtag

DBGET integrated database retrieval system