KEGG   Drosophila willistoni: Dwil_GK17198Help
Entry
Dwil_GK17198      CDS       T01067                                 

Definition
GK17198 gene product from transcript GK17198-RA
Orthology
K00012  
UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
dwi  Drosophila willistoni
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dwil_GK17198
   00053 Ascorbate and aldarate metabolism
    Dwil_GK17198
   00500 Starch and sucrose metabolism
    Dwil_GK17198
   00520 Amino sugar and nucleotide sugar metabolism
    Dwil_GK17198
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     Dwil_GK17198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 476 aa AA seqDB search
MKVCCIGAGYVGGPTCAVMALKCPDIVITLVDKSSERIAQWNSDKLPIYEPGLDEVVKKC
RNVNLFFSTDIETAIKDADLIFISVNTPTKISGNGKGRAADLKYVESAARMIAEIAQSNK
IVVEKSTVPVRAAESIMHILRANQKPGIHYDILSNPEFLAEGTAINDLLNADRVLIGGEE
TPEGHQAVEKLSWIYEHWIPKKHILTTNTWSSELSKLAANAFLAQRISSINSLSAVCEAT
GADVSEVARAVGLDSRIGSKFLQASVGFGGSCFQKDILNLIYICENLNLPEVAAYWQQVI
DMNDYQKRRFSQKIIESLFNTVSDKRIAILGFAFKKNTGDTRETAAITVCQTLLEEGAKL
DIYDPKVEPEQIIDDLTHPSVTESPENVKKAVQIHSDPYSAVRSTHALVVCTEWDEFVDL
DYTRIYQSMMKPAYIFDGRKILDHERLQQIGFHVQTIGKKYQRTGLLRSWGIVPQL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttgttgtattggcgctggttatgtgggcggtccaacatgtgcggtaatggca
ctcaaatgccccgatattgttataaccctggtggataaaagttccgagcggattgctcag
tggaattcggataaattgcctatttatgagcctggcctagatgaggtagtcaagaagtgc
cgaaatgtgaatctatttttctccaccgacattgagacggcgattaaagatgcagatctc
atctttatatcagtcaacacgccaacaaaaataagcggcaatggcaagggacgagctgct
gacctgaaatatgtggaaagtgcagcccgtatgattgccgaaattgctcaatcaaataaa
attgtcgtggagaagagtacagtgccagtgcgagctgccgaaagtattatgcatatattg
agggcaaatcaaaagcctggcatacattatgatatactatcgaatccggaattcttggcc
gaaggaacggctatcaatgatttacttaatgctgatcgtgttttaattggtggcgaagag
acaccggaaggacatcaggcggtagagaaactatcatggatctatgagcattggataccc
aagaagcatatattgacgaccaatacatggagtagtgaattgtccaaattggcggcaaat
gcatttctagcccaacgcatttccagtattaattccctatcggctgtgtgtgaagccacc
ggtgccgatgtctctgaggtggcacgtgccgttggtctggactcgagaattggttccaaa
tttctgcaagcatcggtgggctttggcggtagttgtttccaaaaggatatactcaatttg
atatacatttgcgagaatcttaatttgcccgaagtggcggcctattggcaacaggttatc
gatatgaatgactatcagaagcgacgtttctcgcaaaagataatcgagagtctgttcaat
acggtgtcggataaacgtattgccatattgggttttgcatttaagaagaatacgggcgat
acacgggaaacggcagcgattacggtgtgccaaacgttgctggaggagggtgccaaactg
gatatctatgatccgaaagtggagcccgagcaaataatcgatgatctaacgcatccaagt
gtaaccgaatcgccggagaatgtaaagaaggccgtacagattcacagtgatccgtatagt
gcggttcgatccacacatgccttggttgtgtgcaccgaatgggatgaatttgtggatttg
gattatacacgcatctatcagtcgatgatgaaaccagcatatatcttcgatggccgtaag
atccttgatcatgagcgtttgcagcaaattggtttccatgttcagacaattggcaaaaag
tatcagcgtacaggacttttacgatcctggggaattgtgccgcagctgtag

DBGET integrated database retrieval system