KEGG   Drosophila willistoni: Dwil_GK17300Help
Entry
Dwil_GK17300      CDS       T01067                                 

Definition
GK17300 gene product from transcript GK17300-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dwi  Drosophila willistoni
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dwi00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 524 aa AA seqDB search
MVNKLVIVLGLCLLGLNLVNLAAVPKRLRINEEEEMHPVFAQKTMRSSMRLNPEEAEQDY
WLEASKKHILEKLSYVRNTNKAKNIILFLGDGMGLATLAAARNLLGGEEMKLSFEEFPYT
GLSKTYSVDKIVPDSACTSTSYLCGVKANYGTIGVNAHVKRGDCLAMANETNHVYSLGKW
AMDKGKAAGLVTTTRVTHASPSGVYAHTADREWENNAVLEEACPGELGENLNDIAVQLIH
GEVGSKLKVMLGGGKRSFYAPEFYDKGRRTDGRNLVEEFEALDEGNVFVKTQKKLLNVNA
TETGRLLGLFSKSHLHYHLEQLADEENNEPTLEEMTQKAIEVLQTEEQGYFLFVEGGKID
ISHHDTMARIALDETVELSKAVKLARAMTSVEDTLIVVTSDHSHTFSLSGYQPRHSDIFS
EAESKGTDGKPYLPLSYANGLSFDSFYNTEGHQRYDPLAQRTGEFDEIFPAMAPLLSETH
GGEDVGVFASGPWAHLFTGVYEQNSIPHMMAYAACVGDGQTACD
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggttaacaaattggtcatcgtattgggtctatgcctgttggggctaaatctggtcaac
ctggcagccgtgcccaaacgactgcggatcaacgaagaagaggaaatgcatccagttttc
gcacagaaaacgatgcgttcatccatgcgcctgaatccggaggaagctgagcaggattat
tggctggaggccagtaagaagcatatcctggagaaactctcctatgtgcggaacacgaac
aaggccaagaatattatacttttcttgggcgatggcatgggactggccacattggcagcg
gcacgcaatttacttggcggtgaggagatgaaactatcctttgaagagttcccctacaca
ggactttcgaagacctattcggtggataaaattgtgcccgacagtgcctgcacttccacc
tcctatttgtgcggtgtcaaggccaattatggcaccattggagtgaatgcccatgtgaaa
cgtggcgattgcttggccatggccaatgaaacgaatcacgtctattcgctgggcaaatgg
gctatggataagggtaaggctgccggcttggtgaccaccacccgagtgacacatgcctcg
ccatcgggtgtctatgcccatacagcggatcgtgaatgggagaacaatgctgtcctggag
gaggcatgtcctggtgaactgggtgagaatctcaatgatattgccgttcagctcattcac
ggtgaagtgggcagcaagttgaaggtgatgctgggcggtggcaaacgtagtttctatgct
cccgaattctatgacaagggcagacgcacagatggccgcaatttggttgaagaattcgaa
gccctggacgagggcaatgtctttgtgaaaacgcaaaagaaactgctgaatgtgaatgcc
accgaaacgggtcgtcttctgggtctattcagcaaaagtcatttgcattaccatctcgag
cagttggccgatgaggagaacaatgaacccactctggaggagatgacccaaaaggccatc
gaagtgctgcaaacggaggagcaaggctatttccttttcgtcgagggaggcaaaatcgat
ataagtcatcatgatacaatggcacgcatagctctggatgaaacggttgagctctcgaag
gctgttaaactggcacgtgccatgaccagtgtggaggatactctaattgtggtcacctcg
gatcattcgcatacgttcagcttgtctggctatcagccgcgtcacagtgacatcttcagt
gaggccgaatctaagggtacggatggcaaaccctatttaccccttagctatgccaatggc
ctgagtttcgatagtttctacaataccgaaggacatcagcgttacgatcctttggctcag
cgtacgggggaattcgatgaaatcttcccagctatggcgccattgctttccgaaacccat
gggggtgaggatgttggtgtctttgcttctgggccatgggctcatctttttacgggtgtc
tatgaacagaattcgattccccatatgatggcctatgctgcttgtgtcggagacggacag
acggcgtgtgattag

DBGET integrated database retrieval system