KEGG   Drosophila willistoni: Dwil_GK17305Help
Entry
Dwil_GK17305      CDS       T01067                                 

Definition
GK17305 gene product from transcript GK17305-RA
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dwil_GK17305
Peptidases [BR:dwi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dwil_GK17305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1704 aa AA seqDB search
MTDTTTTTTATTTDNNNVKSKTSAPECTVSVYDQTPGSQQKKINVVLRSHYTVQHVINLI
GTQFPYGKFELILQPHDNKDLVHLNNLESQLMYEVAGFEHQLKNSLVLLPSGSWDGNVTK
RFELPLKKAQGLVSLHSKEKTTTKSTSPIKRDTTTGSPTKKEKSTETSSTTSSPIKKEKS
DTKKEKKEIITTTTTTTATTTTSEAATETIDILGETTPTISPNKKKSSVTGETIKKKRVT
ATTTGEKSTTTTKKKSSSSKAAQTTGSPSKTKSTIQEEEVVVVVDGDDDKNDDNNEVEAV
RAAAVVAAATTIIENGTTKITTSTSTSTSTTTTATSCYDNNMSIDELTKAEISDQLPQPQ
NRILISPIDDHAPSELFNISPVSDAEQLSDDDLALGASASPTTLIRDPFVFGGDANNSLE
NRGANGDQMVSSKDVGLDGIGTEDGQESDLSNFYRRKYGGDDLPSWQKINTTAADFVASA
TTEREGGASGTSTTGTATGTSSSSAAPAAGASGGASSSSRPSSRGYVGLINQAMTCYLNS
LLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSHKSSVETTDLTRSFGWD
STEAWQQHDIQELCRVMFDALEHKFKNTKQANLISTLYEGKMNDYVKCLECNTEKTREDT
FLDIPLPVRPFGSSSAYGSIEEALRAFVRPETLDGNNQYLCEKCKKKCDAHKGLHFKSFP
YILTLHLKRFDFDYQTMHRIKLNDRVTFPQTLNLNTFINRNSNGGGEQYQMNGHNLDDCS
TADSGSAMEEDNLSSGVVTTASSSQHENDLNDEDEGIDMSSSTSKSTKQDAGPYMYELFA
IMIHSGSASGGHYYAYIKDFDNQEWFCFNDQNVSPITQEDIQRSFGGPNGSYYSSAYTSS
TNAYMLMYRQVDDKRNERVVKSLDFPEHIKSLLPKLHAEEETRVTRLGRHVTVTDLALPD
LYKPRVYFYNPSLKKLKVTRVYVSSSFDINSVLSTAYEMLNVEQFAPLSQCRLVAYNSSM
DTIIQSLESCTDPSLTELRASQNFSLDFLLEYRLEDQQFEVYEPDGSTWYVYKVELSTMS
MDGPFLVYSAARESSDVLRHSIATRLHIKDEDQFLLATVRGSFRKAFVAYDPQPTPEAQL
QLQNLANTQFKNITYFYLNVPNTDAASLEMLGVPSKEVAALVAATTTPTTTTATEPLNGG
DVVDAALMNGSAVGEMLPSNDCDWRRYKGDLLDPLSVPPGHESNSEDSSLSDGDRTLVET
ESLQHRGGGDSQVSSTSHSPQLSSPEDEAASHDAMMRVHAYCNGNGSYSAADAMDSSNGS
GAGVTNHFFHASKIDCVDIVAGTTSSASSGHLSDDEANLRKPTCAYKLLVGTQMRMGAFK
RHIEQLIRVPNAYFKLQRKNENNIPNNQNNLLISLNEGETLTVELGKTLQPDEYKAKIHF
LRLCDLDNETARLPCVCEWVYNTNTTVEQAKQELVAKLQRIDSKYSSLTVENCRIWLKGG
RSLIKIMSNDETLYCDMRSTTSTEFIIQECEEGIVTQPSEDALTIFVRQWYPQKMEFGKF
QEVTLEKDSEIRRSLSQICDITIDKLSYMKVNSNFPCTNISAVSINESSSWFSVPGTLDT
YPLNNSQTGNMYLYKDKSIAARELTLEERRQMSAKEKARLDRLGCISTTRYSQRRERALK
IYLDSPEKSNNVSASAPMDAHVEH
NT seq 5115 nt NT seq  +upstreamnt  +downstreamnt
atgacagacacaacaacaacaacaacagcaacgacaacggataacaacaacgtcaagagc
aagacaagtgccccagaatgcaccgtgtcggtatatgatcagacacccgggtcacagcaa
aagaagatcaatgtggtcttacgttcacattataccgtacagcatgtcattaatttgatt
ggcacacaatttccgtatgggaaatttgagttaatcctccagccgcacgataacaaagat
ttggtgcatctgaataacttggaatcacaattgatgtatgaggtagcaggatttgagcat
cagctgaaaaatagtttggttctcttaccctcaggcagttgggatggtaatgtgacgaaa
cgttttgagttacccctaaagaaggcccagggattggttagtctgcatagcaaagagaaa
acgacgacaaaatcaacatcgcccataaagagggataccacaacgggatcaccaacgaaa
aaggaaaagtcaacggaaacatcatcaacaacgtcctctccaattaagaaggaaaaatca
gacaccaaaaaggagaaaaaggagatcatcacaacaactacaacaacaacagcaacgact
actacgtcggaagcagcaacggaaacgatagatatcttaggggagacaacaccgacgata
tcaccaaataaaaagaagtcctcagtcactggggagactatcaaaaagaaacgtgtaaca
gcaacaacaacgggtgagaaatcgacaacaacaacgaagaaaaaatcatcttccagcaaa
gcggcccaaacaacgggcagtcccagtaaaaccaagtcaacgattcaagaggaagaggtc
gtggttgtggtggacggcgacgacgacaaaaacgacgacaacaacgaggtggaggcggta
agagctgcagctgttgtggcagcagccaccacaattatcgagaatgggacaacgaagatc
acgacgtcaacctcaacgtcgacatcgaccacgacgacggcgacttcctgctatgacaac
aatatgtccattgacgagttaaccaaagctgagatatccgatcaattgccgcagcctcag
aatcgtatcctgatctcacccattgacgatcatgccccatccgagctattcaacataagt
cccgtctcagatgcggaacaattgtcggacgatgatttggccttgggcgcctcggccagt
cccacaactctaataagagatccatttgtctttggcggtgacgccaacaattcgttggag
aatcgcggagccaatggcgatcaaatggtctcatccaaagatgtgggcctcgatggcatt
ggcacagaagatggacaagagtcggatctatcgaatttctatcgtcgtaaatatggtggc
gatgatttaccctcatggcagaagattaacacaacagccgctgattttgtggcctcggcg
acgacagagcgggagggcggtgcatcgggaacatcaactacaggaacagccacaggcaca
tcatcgtcatcagcagcaccagcagcaggagcaagtggtggtgcatcatcttcatcccgt
cccagtagtcgtggttatgtcggtctcatcaatcaggccatgacatgctatctaaacagt
ctactccaggctctctttatgacgcccgaattccgtaatgccttatatcgatgggaattt
gataatgacaacgaggccaagaatatcccataccaattgcagaaactattcctaaatctc
cagacatcacacaaatcatcggtggagacaacggatctgacacgcagttttggttgggat
tcaaccgaggcgtggcaacagcacgatatccaagagctatgtcgcgtcatgttcgatgcc
ttggagcataagttcaagaataccaaacaggcgaatctaatatcgacattgtatgaaggc
aaaatgaacgattatgtcaagtgtctggaatgcaacacagagaagacgcgcgaggatacc
ttcctggacataccattgccagtgcgcccatttgggagcagctctgcctatggcagcatt
gaggaggcattgcgtgcctttgttcggccagagactctggacggtaataatcaatatctg
tgcgagaaatgcaaaaagaaatgcgatgcccacaaaggattgcatttcaaatcatttccc
tatatattgacactgcatctgaagcgtttcgatttcgattatcagaccatgcatcgcatc
aaactgaacgatagagtaacctttccgcaaacacttaatttgaatacgttcatcaatcgg
aactcgaatggtggtggtgaacagtatcaaatgaatggtcacaatttggacgattgcagt
acagcggacagtggctcagccatggaggaggataatctgagtagcggcgtggtgaccact
gccagttccagtcagcatgagaacgatctaaatgacgaggacgagggcatcgatatgagc
agcagcactagcaaaagtaccaaacaagatgccggcccatatatgtatgaactattcgcc
ataatgatacattcgggcagtgcctcgggtggtcattattatgcctatatcaaggatttt
gataatcaagaatggttctgtttcaatgatcaaaatgtatcgcctatcacgcaagaggat
atacaacgttcgtttggtggtcccaatggcagttattattccagcgcatatacctcatcg
acaaatgcctatatgctgatgtatcgtcaggtggatgacaagcgaaatgaacgtgtcgtt
aagagtttagattttccggagcatattaaatctttgctgccgaaacttcatgccgaggag
gagacgcgtgtcacgcgtttgggtcgacatgttactgtcacagatctggccctgcccgat
ctgtataagccccgcgtttatttctataatccatcgttgaagaaactaaaagtgactcgt
gtctatgtgtctagtagttttgatattaactctgtcctatcgaccgcctatgagatgtta
aacgttgaacaattcgcaccgctcagtcaatgtcgtttggtggcctataattcctcaatg
gatacgattattcagtcactggagagctgtacggatccatcgctgaccgaactgagggct
tcacagaatttcagtttggacttcctattggaataccgtctggaggatcagcagtttgaa
gtctacgaacctgatggttctacatggtatgtttataaggtagaactatcgaccatgtcg
atggacggtcccttcctggtttattcagcagcgcgggaatctagcgatgtcctacgccac
tcgattgccactcggttacacatcaaggatgaggatcaattcctattggccaccgtgagg
ggttccttccgcaaagcctttgtcgcctatgatccccaaccgacgcccgaagctcaattg
caattacagaatttggccaacacgcaatttaaaaatattacctacttctacttgaatgtg
cctaacactgatgcagccagtttggaaatgttgggagtgcccagtaaggaggtggcagca
ctagtagcagcaaccacaacgccgacgacgacgacggcgacggagcctttaaatggcggc
gatgtggtagatgctgccctcatgaatggctctgctgtgggcgagatgttgccgagcaat
gactgtgattggcgtcgctataaaggtgatctattggatcctttgtcggtaccgcctgga
catgaatccaattcagaggatagcagcctaagcgatggtgatcgcactctcgttgagaca
gagtccctgcaacatcgcggcggcggcgatagtcaagttagctccaccagtcactcacct
caattgtccagtcccgaggatgaggccgcctcccatgatgccatgatgcgtgttcatgcc
tattgcaatggcaatggcagctactcagccgccgatgccatggactcgagcaatggttct
ggcgctggagtcaccaatcactttttccatgccagtaaaatcgattgcgtggacattgtg
gccggcaccacgagttcagccagttcgggccacctctcggatgatgaggccaatctaagg
aaacccacctgcgcatacaaactcctggtaggcacccagatgcgtatgggtgcctttaag
cggcatattgagcagctgattagggtgccgaatgcctatttcaagctgcagcgcaagaac
gagaacaacatcccaaataatcagaataacttgttaatcagtctcaatgagggtgaaacc
ctgaccgttgagttgggtaaaacccttcagcccgatgagtacaaggccaaaatacatttt
ctccgtctctgcgatttggataacgagacggcgcgtctgccatgcgtctgtgaatgggtc
tataataccaataccacagtggagcaggccaaacaagaactagtagccaaattgcaacgc
atcgatagcaaatactccagtctgactgtggagaattgtcggatctggctaaagggcggc
aggagtttaatcaaaattatgagcaacgatgagacgctttactgtgacatgagatcgacc
acctcaactgagttcattatccaagagtgcgaagagggaatcgtaacgcagccaagcgag
gatgctttaaccattttcgtaaggcaatggtatccacagaaaatggaatttggcaaattt
caggaagtcaccttggagaaggatagtgaaatcagacgctctttatcacagatttgcgat
atcaccatagataaactaagttatatgaaggtgaacagcaattttccctgcacaaacata
tcggctgtcagcattaatgagtcaagcagttggttctcagtacccggaactctggacaca
tatccgctgaataacagtcagactggcaatatgtatttgtacaaagataaaagcatagcc
gcgcgtgaattgacattagaggaacgcaggcaaatgagcgccaaggagaaggcacgtctg
gatcgcttgggttgcatttcaacaacacgctattcccagcgtcgggaacgagccctaaaa
atctatttggattcaccggagaaatcaaataatgtttcggcctcggctccaatggatgcg
catgttgaacactag

  All links  
No link information was found.   
DBGET integrated database retrieval system