KEGG   Drosophila willistoni: Dwil_GK17399Help
Entry
Dwil_GK17399      CDS       T01067                                 

Definition
GK17399 gene product from transcript GK17399-RA
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dwi  Drosophila willistoni
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dwi00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 228 aa AA seqDB search
MISFLFIVNRAFSSSTSRSSVSSKIMSHGPRPLVLCGPSGSGKSTLLKRLFAEFPTTFGF
SISHTTRKPREGEEHGVHYYFVERPEMELAIANDEFIETAEFSGNMYGTSKAAVREIQNQ
GRVCILDIEQKGVEQIRKTDLNPILIFNNPPTIEELERRLRLRGSETEETLRKRLDAAQV
EISYGLTPGNFHKIINNVDIDVAYTEFRDFVVQELKQQEAEGVRVSLN
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgattagctttctgttcattgtaaatcgggcattcagcagtagcaccagcagaagcagc
gtcagcagtaaaataatgtcgcatggtccccgccctttggttttatgcggcccctccggt
tccggcaagagcacgctgctcaaacgtttgtttgccgaattcccgacaacatttggcttc
agcatatcacatacgacacgtaagccacgtgaaggcgaggagcatggtgtccactactat
ttcgtggagcgtccagaaatggaattggccattgccaacgatgagttcattgagacggcc
gagttctctggtaatatgtacggcaccagcaaggccgctgtccgagaaattcaaaatcag
ggacgtgtctgcatattggacattgaacaaaagggtgtcgaacagatacgcaaaaccgat
ctcaatcccatattgatcttcaataatccacctaccatcgaggagctcgaacgtcgctta
cgtctacgcggctccgagacggaggaaacgttgcgcaaacgcttggatgcggctcaagtg
gaaattagctatggcctaacgcccggaaatttccacaagatcataaacaatgtggatatt
gatgtggcctatacggaatttcgcgattttgttgtccaagagctaaaacaacaggaggct
gagggtgtgcgtgttagcctcaattag

DBGET integrated database retrieval system