KEGG   Drosophila willistoni: Dwil_GK17412Help
Entry
Dwil_GK17412      CDS       T01067                                 

Definition
(RefSeq) GK17412 gene product from transcript GK17412-RB
  KO
K03103  
multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dwi  Drosophila willistoni
Pathway
Glycolysis / Gluconeogenesis
Inositol phosphate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dwil_GK17412
   00562 Inositol phosphate metabolism
    Dwil_GK17412
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Dwil_GK17412
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Dwil_GK17412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 214 aa AA seqDB search
MQSAVDYVRSRTQLEDLQPEDVELMYTVCAFETAWQRPLGHFRPSVWCSFFDVEALNALE
FVEDLEYYWNDGYGYKLSHRIACPAIADMFEAIDTPTAKANATFYFTHSGTLLKLLAHLG
LAKDEEMLTHKHFDYARQWRTSRIDAFATNLAFLRFDCEKGPHVLVLHQEQVVHLPGCPQ
DNDLCPLATLRLLFRESIENCDFDTLCQINGNAN
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcagcagtggattatgtgcggagcaggacgcagctggaggacttgcagccggag
gacgttgaactcatgtatacggtatgtgcctttgagacagcatggcaacgaccacttgga
catttccggccatcggtgtggtgtagtttcttcgacgtggaagcactgaacgcactggaa
tttgtcgaagatttggaatattattggaacgatggctatggctataagttgtcacatcgc
attgcctgtccggcaatagcggatatgtttgaggccattgatacaccgacggctaaagcc
aatgccaccttctatttcacacattcgggcacactgcttaagctgctggcccacctcggc
ttggctaaggatgaggagatgctgacgcacaagcattttgattatgcgcgtcaatggcgc
acaagtcgaattgatgcttttgcaacaaacttggcctttctgcgctttgattgtgagaag
ggaccccatgtactggtgctgcatcaggagcaggttgtacatctgcctggctgtccgcag
gataatgatctctgtccccttgcaacgttgcgtctcctatttagggagagcatagagaac
tgtgactttgacactctctgtcaaatcaatggaaacgccaattga

DBGET integrated database retrieval system