KEGG   Drosophila willistoni: Dwil_GK17412Help
Entry
Dwil_GK17412      CDS       T01067                                 

Definition
GK17412 gene product from transcript GK17412-RA
Orthology
K07204  
regulatory associated protein of mTOR
Organism
dwi  Drosophila willistoni
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dwil_GK17412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1985 aa AA seqDB search
MLYIWLTLLSLILLWNTTTADLGSNHETCCALTRLDIETRLSTKSPYRSIANYNDTQPHY
PGCVPTRIWATIRHGTRMPSKSVIARAQERLTVIQDMLLQQAKPKLCAKELEQLRKWSWQ
HFNPEDDEKLLMAEGENELIELAERMQLRFPSLLPDPYDPDWYYMKYTATQRTLKSAQSF
ATGLFGRHRIHTVNYPRPLHRDPILRIAVFATCAPLLQGVSKYRPSLDQNPMLESHYNEA
AAAAAAAVVVGDSSNNSSNSNSSSSNGSTVNIMMTSLDSSLNAHKFAWIELRDAAGGSVD
RAEELLLDLTQDYSNRTFGDHQCPLSFAAKRHQESIEAMAYERRAWRIRERMKTASVALV
LCLNIGVDPPDVVKIQPCSRLECWIDPSSVSAPKAMEMIGNNLQMQYERWQPRARYKKCH
DPTVEDVKKLCTSLRRNAKGERILFHYNGHGVPKPTANGEIWVFNKTFTQYIPLSIFELI
TWMAAPSIYVYDCSNAGIIINSFQPYAEQHEHEREKAIAAAQQRGMGSMTGPGMVPNQIS
YKNCIHLAACAANEILPMNSQLPADLFSSCLTTPINIALKWYAMQEKLGMVPRIHSELID
KIPGKVNDRRTMMGELNWIFTAITDTIAWNTLPRELFQRLFRQDLLVASLFRNFLLAERI
LKSHDCTPVSLPALPPCHRHPMWKAWDLVVDLALQQLPDILEYNAPYKQLPFFEHQLTAF
QVRLDSESESRTPPEQLPIVLQVLLSQVHRLRALELLARFLDLGPWAVNLALGVGIFPYV
LKLLQSSTRELRPVLVFIWAKILAVDPSCQVDLVKEYKYFLSVLQDTTVSKEHRTLSAFV
LSSIVHNFLLGQTSALQGPLLSICLEQLNDGSWLLRQWLAICLGMLWQNFENARWSGARD
LAHEKLYVLLRDAIPEVRAAAVFALGTFISSVTDRRQQQANNIDRIIAITLLETVGEDMS
PLVRMELAAALQWMVLLFESQFVTVYMLEHLNAHTDALVSSGERSASITHGMPGAPPAST
TSSTHSLERHVTMRRGVSSSSISNMSGASSTAPGTGSNAIPFQSIFTKLWLGIYNLGQDP
FPQVAATAQKIINHVRDAALYPITAKEVTINTVTEKCSSLSVSLPPSPNTRINYLGGGGP
GGGGAVGIASAAGEASSPVGSSTTMGAGGAAAANAGGSHWAHKLRLSGSSTGAGGDPQLT
LHRKLRTSSTNDDTDSGPASAPVPPVSSVEGCHSARSSGSESNHYPDPGKVGQPRQPIVK
TQFIPWAMSYFTRAGKERYSSSEGSGEEGQQRWPIDRNSTELRIRNYRYHRNESIRREAK
KMSYCHQRMDAYTWMRKTQFTPSIVKLLPYEQQIAVAYKERVLVYDFQRNAVRAYGSDSI
AGNVSGGGSGTVSGSSTSLNGNTPRKTGLGTSGGSSSSSSSSSSSYAAFARVSSIEFINA
HDVGLELVAHEDGVIRVWQSTQPPSGGDGINTLSSSLASSSLNSSFVEEPSNGTRLVTAW
DALPHVSQPNWGTSTLRHRGGLARSTTDQLMSSSTGIVTAWQQYSQQLIVGGGSCRFLRI
WDVERELRLNDLPLGRSEASVRVLSPFASNVRCDLIVAGCADGSVRLFDKRLAPQEARIH
DYREHASPILHACLRANETTLVTGCTGGRICVLDLRARGNGRSRLHQWDAGGDVTAMACH
QLADAVACGNAAKISIYSLNGKQQSVLRSNEGFMGSKIGHPTCLSFHAYKMQLAVGFVDN
TFYKLCGRWKIDVKKNPETLVNARRFYAEPQMQSAVDYVRSRTQLEDLQPEDVELMYTVC
AFETAWQRPLGHFRPSVWCSFFDVEALNALEFVEDLEYYWNDGYGYKLSHRIACPAIADM
FEAIDTPTAKANATFYFTHSGTLLKLLAHLGLAKDEEMLTHKHFDYARQWRTSRIDAFAT
NLAFLRFDCEKGPHVLVLHQEQVVHLPGCPQDNDLCPLATLRLLFRESIENCDFDTLCQI
NGNAN
NT seq 5958 nt NT seq  +upstreamnt  +downstreamnt
atgctatacatttggttaactctgttgtctctcatactgctgtggaacacaacaacagct
gatttgggttccaaccatgaaacatgctgtgctctgacccggttggacatcgagactcgc
ttgtccacgaagtcaccatatcgctccatagccaattacaatgatacccaaccacattat
ccaggttgcgtacctacgcgtatctgggcgactatacgccatggtactcggatgccgagc
aaatctgtgatagcccgcgcccaagaacgtttgacagtcatacaggatatgctgctgcag
caagcgaaaccaaagttgtgtgccaaggagctggaacaattgcggaagtggagctggcag
cattttaatccggaagatgatgagaaacttttgatggcggagggagaaaatgagttaatc
gagctagcagagcgtatgcaactgcgattcccttcactgctgcctgacccctatgacccg
gactggtattatatgaaatacacggcaacacagcgaacgttgaaaagcgcacagagcttt
gccacggggttgtttggacgacatcggatacacacggtcaactatccacgacctttgcat
agagatcccatactaagaatagcggttttcgcaacctgtgcaccgttgctacagggcgta
tcgaaatatcgcccatccctagaccaaaacccgatgctagaatcgcactacaatgaggcc
gctgctgctgcggcagccgccgttgtcgttggggacagtagcaataacagcagcaacagt
aacagcagcagcagcaatggcagcactgtcaatataatgatgaccagtttggattcctca
ttaaacgcccacaaatttgcctggatagagttgcgggatgcggccggcggcagtgtagat
cgggccgaggaacttcttttggatctgacacaggattattccaatcgcactttcggcgat
catcaatgtccgctctcgtttgccgccaaacgccaccaggaatccattgaggcaatggcc
tatgagcggcgtgcctggcggatcagagaacgcatgaagacggccagcgtggccctggtg
ctatgtctcaacattggcgttgatccgccagatgtggtgaaaatccaaccttgttcacgt
ctggaatgctggatcgatcccagctcggtgtcggcgccaaaggcaatggaaatgattggc
aacaatctgcaaatgcagtacgaacgctggcagccccgtgccaggtataagaaatgccac
gatcccacagtcgaggatgtaaagaaactctgcacttccctgcgacgcaatgccaagggg
gagcgcatcctcttccactacaatggccacggtgtacccaagccgacggccaatggtgaa
atttgggtctttaacaagactttcacacagtatatcccgcttagcatattcgagctaatc
acttggatggccgctccctccatttatgtgtacgattgctccaatgccggcatcattatc
aattccttccaaccctatgcggagcagcacgagcatgaacgtgaaaaggccatagctgct
gcccagcaacgggggatgggttctatgacaggaccgggcatggtgcctaatcaaattagc
tacaaaaactgtattcatttggccgcctgtgccgcaaatgagatacttccaatgaactcg
caattaccggccgatctattttccagttgcctaaccacacccattaatatagccttgaaa
tggtatgcaatgcaggaaaagttgggaatggtgccgcgtatacacagcgagctgattgat
aagattccaggcaaagtcaacgatcgacgcacaatgatgggtgaactaaattggatattt
acagctattaccgacacgatagcgtggaatacattgccgcgcgagctctttcaacgtctg
tttcgccaagatctcctggtggccagtttgtttcgcaattttctattggccgaacgcata
ttgaagagtcacgattgtacacccgtatcgttgccggctctaccgccttgccatcgtcat
ccgatgtggaaggcgtgggatctggttgtggatttggcactacaacaattaccggacatt
ctggaatataatgctccatacaaacagctgccattcttcgagcatcagctgaccgcgttt
caggtgagactggatagtgaatcggaatcacggaccccgccggagcaattgcccattgtg
ctgcaagtgttgctctcccaggtgcatcggctgagggcattggagctactggcccgattc
cttgatttgggaccctgggctgtcaatttggctctcggagtcggcatctttccctatgtg
ctcaaattgctgcagagttcgacgagagagttgcgtcccgtattggtcttcatatgggct
aaaattctcgcagtagatcccagttgtcaggtggatctggtgaaggagtacaaatacttt
ctgtccgtgctacaggataccacggtgtccaaggaacaccgcacactctccgcctttgtc
ctatcgtcgattgtacataatttcctgctcggccagacgagtgccttgcagggtcccctg
ctgtctatatgcctggagcagcttaatgatggaagttggctgctccgccaatggctagcc
atttgcctgggcatgttgtggcagaactttgagaatgcccgctggtcgggtgcccgcgat
ttagcccacgagaagctctatgtgcttctacgggatgccattcccgaggtgagagcagcg
gccgttttcgctttgggcaccttcatcagctctgtgacggatcgtcgccagcagcaagcc
aacaacattgatcgcattatagccatcactctgctggagacggtgggggaggatatgtcg
ccgctggtgcgcatggaactggctgctgccctccaatggatggtgctgctcttcgagtca
caatttgtcacggtctacatgctggaacacctgaatgcccacaccgatgcgctcgtctct
agcggcgagcgaagcgccagcattacccatggtatgcctggagctccgcccgcttccaca
acctcgtccacacatagcctggagaggcatgtgacgatgcggcgtggcgttagttcgagc
tcaatatcgaatatgagcggagcctcgtcgacggcgccgggcactggatcgaatgccata
ccctttcagtcgatcttcacaaaactttggctcggcatctataatctcggccaggatccg
tttccccaggtagcggcgaccgcccaaaagataatcaatcatgtgcgcgatgcagctctc
tatccgattacggccaaggaggtaaccatcaacacggtcacagagaaatgtagcagcctg
agcgtcagtctgccacccagtccgaataccaggatcaattatctcggcggcggcggccct
ggtggtggtggtgctgttggcattgcatcggcagctggcgaagcttcctcaccggtgggc
agctcgactacaatgggggcaggaggagcagcagcagctaatgcaggcggcagccattgg
gcacacaagcttcgcctctccggcagttccactggcgctggcggagatccacagttgaca
ttgcatcgcaaacttcgcactagttccaccaacgacgacacggacagcgggccagcatcg
gcgccggtgccgccggttagttcggttgaaggttgccactcggccagaagcagtggcagc
gagagcaatcactatcccgacccgggcaaggtgggtcagccgcgtcagccaattgtgaag
acccaatttattccctgggccatgtcgtatttcacgcgagctggcaaagagcgatacagt
tcatctgagggcagcggtgaggagggccagcaacgttggcccattgaccgcaattccacg
gagctgcgcattagaaactatcgctatcatcgcaacgaatctatccgcagggaggcaaaa
aagatgtcttattgccaccagcgaatggatgcctatacatggatgagaaaaacacaattt
acgccatcgatagttaaactattgccgtacgagcagcagattgccgtcgcctacaaggag
agggtgcttgtctatgacttccaaagaaatgccgtgcgtgcctatggttcagattcgatt
gctggcaatgtcagtggcggtggcagtggaactgtcagtggcagctccacatcgctcaac
ggtaatacaccgcgcaaaacaggattgggaacatccggtggctcttcatcctcctcgtcg
tcgtcgtcttcgtcgtatgccgcatttgctcgggtgagcagcattgagtttatcaatgcg
cacgatgtgggcttggagctagtcgcccatgaggatggggtcatacgtgtttggcagtcc
acacagccgccgtcgggtggtgatggcatcaacacactttcctcttccttggcatcctcc
tcactgaattcctcgtttgtggaggagccatccaatggaacccgcctagtcacagcttgg
gatgctctgccacatgtgtcgcagccaaattggggcacctcgacactccggcatcgcgga
ggtcttgccagatctaccacagatcagctcatgagctccagcacgggcattgtcaccgcc
tggcaacaatatagtcagcagttgattgttgggggtgggtcttgccgctttctccggatt
tgggatgtggagcgggaactgcgactgaacgatttgccccttggacgcagtgaggccagt
gtccgtgtcctttctcccttcgccagcaacgtgcgctgtgatcttatcgtggccgggtgt
gccgacggaagcgttcgactttttgacaaacgtctcgcaccgcaggaggcgcggatccat
gactatcgggaacatgcctcccccatacttcatgcctgcctaagagccaatgagacgact
ctggttactggctgcacaggcggtcgtatttgtgtcctggacctacgtgctcgtggcaat
gggcgttcccgtctccatcaatgggatgctggcggtgatgtcactgccatggcgtgccat
caactcgccgatgctgttgcctgtggcaatgctgcgaaaatttccatttattcgctaaat
ggcaagcagcagagtgtcctgcgcagcaacgagggattcatgggctccaaaatcggtcat
cccacctgcctttcgtttcatgcgtacaaaatgcaattagcggtgggattcgtggacaac
acgttttataaactctgcggccgttggaaaattgatgttaaaaagaatcctgaaacattg
gttaatgcacgtagattctatgcagagccacaaatgcaatcagcagtggattatgtgcgg
agcaggacgcagctggaggacttgcagccggaggacgttgaactcatgtatacggtatgt
gcctttgagacagcatggcaacgaccacttggacatttccggccatcggtgtggtgtagt
ttcttcgacgtggaagcactgaacgcactggaatttgtcgaagatttggaatattattgg
aacgatggctatggctataagttgtcacatcgcattgcctgtccggcaatagcggatatg
tttgaggccattgatacaccgacggctaaagccaatgccaccttctatttcacacattcg
ggcacactgcttaagctgctggcccacctcggcttggctaaggatgaggagatgctgacg
cacaagcattttgattatgcgcgtcaatggcgcacaagtcgaattgatgcttttgcaaca
aacttggcctttctgcgctttgattgtgagaagggaccccatgtactggtgctgcatcag
gagcaggttgtacatctgcctggctgtccgcaggataatgatctctgtccccttgcaacg
ttgcgtctcctatttagggagagcatagagaactgtgactttgacactctctgtcaaatc
aatggaaacgccaattga

DBGET integrated database retrieval system