KEGG   Drosophila willistoni: Dwil_GK17633Help
Entry
Dwil_GK17633      CDS       T01067                                 

Definition
GK17633 gene product from transcript GK17633-RA
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dwil_GK17633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 514 aa AA seqDB search
MKINHKYEFDDDVASICESTAALTEGCRLPVRMHKTDDWPLAEIVSIKELDGRRQFYVHY
VDFNKRLDEWVNEEDLYTRKVQFPRRDGSQTGTSTGVTTPQRHHSLAGSASRPTSPQHSS
IGGVSTAPPTPSGSELVNGNNVLAAALQKRINRKRKVHGGSASAHHLQQNVHTPLNTAAA
AHMHVTGDSLVTTTPNGDNDGDGSQDGKIPTPRQSGSMVTHQDDVVTRMKNVEMIELGRH
RIKPWYFSPYPQELCQMSCIYICEFCLKYRKSRKCLERHLSKCNLRHPPGNEIYRKHTIS
FFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYDTDPFLFYVMTEFDSRGFHIVGYFSKEKE
STEDYNVACILTMPPYQRKGYGKLLIEFSYELSKFEGKTGSPEKPLSDLGLLSYRSYWAQ
TILEIFISQNPNTDGEKPTITINDICECTSIKKEDVISTLQNLNLINYYKGQYIVCINRD
TIEQHRRAMEKRKIRIDSKCLHWTPKDWSKRSKW
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaccacaagtatgagtttgacgacgatgtggcttccatttgcgaatcgacg
gctgctttgacggagggctgtcgcctgcccgtgcgcatgcacaagacagatgattggccc
ctagcagagattgttagcattaaggagctggatggtcgtcgtcaattctatgtccactat
gtagacttcaataaacgattggacgaatgggtcaacgaggaagatttatacactcggaaa
gtgcagtttccacgacgggatggctctcaaactggaaccagcacaggagtaactacgccc
caacgacaccattcacttgccgggagtgcatcccgacccacatcacctcagcattcgagt
atcggtggtgtttctacggcgccccctactccgagcggcagcgaactggttaatggtaat
aatgttctggctgctgccctacagaaacgtatcaatcgcaaaaggaaagttcatggtggc
agtgcctctgctcatcatttgcaacaaaatgtgcacacgccattaaataccgctgccgct
gctcatatgcatgttactggcgatagcctagtaactaccacacccaatggcgataatgat
ggcgatggctcacaggatggaaaaattcccactcccagacaatcgggcagcatggttacc
catcaggatgatgttgtaacgcgcatgaagaatgtggaaatgattgagctgggtaggcat
cgcattaaaccttggtatttttcaccgtatcctcaagagctgtgccaaatgtcctgcatc
tacatatgcgagttttgcttaaaatatcgcaagagccgcaaatgtctggagcgtcatctc
tccaaatgtaatcttcgtcatccgccaggcaatgaaatttaccgcaaacacaccatttcc
ttcttcgagattgatggaagaaaaaacaaggtgtacgcacagaatctttgcctgctggct
aaactgtttctcgatcacaagacgctctactacgacacagatccgtttttattttatgtt
atgaccgaatttgattcgcgtggatttcacattgttggctacttttcaaaagagaaagag
agcactgaggattacaatgtggcctgtattttaaccatgccaccctatcaaaggaagggc
tatggtaagcttctaatcgagtttagctatgagttatccaaatttgagggtaaaactggt
tcaccggagaagccattatccgatttgggtttactctcctatcgctcatattgggcccaa
accatattggagattttcattagccaaaatccaaatacggatggagagaagccgactata
acgatcaatgatatctgcgaatgtacttcaatcaaaaaagaggatgttatttctactcta
cagaatcttaacttgatcaactattataagggccagtatatagtttgcattaatcgtgat
accatagaacagcatcgtcgagcaatggagaaacgtaaaatacgcattgactccaagtgt
ctgcattggactcccaaagattggtcgaagcgatccaagtggtaa

DBGET integrated database retrieval system