KEGG   Drosophila willistoni: Dwil_GK17737Help
Entry
Dwil_GK17737      CDS       T01067                                 

Definition
GK17737 gene product from transcript GK17737-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dwi  Drosophila willistoni
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dwil_GK17737
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dwil_GK17737
Translation factors [BR:dwi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dwil_GK17737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 217 aa AA seqDB search
MISAPMETLTFTPNRYMKRKQGNFCNRVTNEVHYNAQFRHPLEHIWTLWYLENDRSKHWK
DMLNEITQIESVETFWSMYYTIKTPSELKIGCDYSMFKRNIKPMWEDEANIKGGRWLITV
AKNSKTELDRIWLDILLMMVGESFDYSYEICGAVINIRAKSNKISVWTANSSNELAILEI
GQKLKMLLHLQTHNLHYQLHSDAMSKINSGVKSVYTL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtgcaccaatggagacgttgacctttacgccaaatagatatatgaaacgaaaa
caagggaatttctgcaatagagtaacgaacgaagtccattataatgcacaattcaggcat
cctctggaacatatatggacattatggtatttagagaatgatcgttccaaacattggaag
gatatgcttaatgagataacacagattgagagtgtagagacattttggagtatgtattat
actataaaaacgccatcagagttgaaaattggttgcgattattccatgttcaagcggaac
ataaaacccatgtgggaggatgaggccaatatcaaaggtggtcgttggctcataactgtt
gccaaaaactccaaaacggaactcgatcgcatctggctggacatattgctcatgatggtg
ggcgagagttttgactattcttatgagatttgtggagccgtcattaatattcgtgccaag
agcaataagatttctgtttggacagcaaatagttcaaatgaattggccattttggagatt
ggtcaaaaacttaaaatgctattgcatttacaaacgcataatctacattatcaattacac
tcggatgcaatgtctaaaatcaattcgggcgttaaatcggtttatactctatga

DBGET integrated database retrieval system