KEGG   Drosophila willistoni: Dwil_GK17965Help
Entry
Dwil_GK17965      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     Dwil_GK17965
Peptidases [BR:dwi01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   Dwil_GK17965
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   Dwil_GK17965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 421 aa AA seqDB search
MYELHSCLNLVFYATIIPGTILISWLTGLVGLATLQASLLVFLLFFVLLPLIFRYSVTLQ
RGILFLTFIRYPKGLDLTNPASIGLYATRNFYITVKDHDQDEDGVSIGVWHVLPKNAVGH
FKTELQVEAAFDIEQAAAEDQQQTSIETFDHDRDYSHELKKLSPALRSEFPVILPENEQL
FYERLLRMPGGTVVLYLHGNTATRGSGHRSEVYKLLRNLNYHVFSFDYRGYADSDPVSPT
EEGVVRDAFMVYEYIANITSNPIIIWGHSLGTGVATHLCAKLAHLKERGPRGVILESPFT
NIRDEIRMHPFSRPFKHLPWFDFTISRPMYSNKLRFESDIHVHEFPQPIMIIHAEDDVVV
PFKLGYELYRIALDTRQRSWGPVEFHRFESKHKYGHKYLCRAPELPSLVQHFVANYRDAV
Y
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagcttcatagttgtttaaatttagtattctatgctacaatcatacccggaaca
atcctcattagttggctaactgggctagttggcctggccaccttgcaagcgtccttgctg
gtattccttttgtttttcgttctactaccgctgatctttcgttattcggtgactttacaa
cgtggaatactctttctcactttcatccgttatcccaaaggacttgatctcacaaatcct
gccagcataggtctatatgccacgagaaacttttatataacagtaaaggatcatgatcaa
gatgaggatggtgtgagcattggtgtgtggcatgtcttgcccaagaatgcagtgggtcac
tttaaaacggaactacaagttgaggctgcctttgatattgaacaggctgcagcagaggat
cagcagcaaacctcaattgagaccttcgaccatgacagagattatagccatgaactgaaa
aaactcagtccagctttgcgttcggaatttccagtgatattgccagagaatgaacaacta
ttctatgagcgactgttacgaatgcctggaggcacagtggtgctctatttgcatggcaat
acggccacccgaggcagtggacatcgttctgaggtgtataagttgcttcgcaatctgaac
tatcatgtcttttcgtttgactatcgaggctatgctgattctgatcccgtttcacccacc
gaagagggtgttgtacgagatgcttttatggtctatgaatatatagccaatattacctcg
aatcccatcattatttggggtcattcactgggcactggagtagccacacatttgtgtgct
aaactggcgcatttaaaggaacgcggtccccggggtgtgatcctggagagtccattcacc
aatatacgcgatgagatacgtatgcatccattttcgcgaccatttaagcatttgccctgg
ttcgatttcaccatttcacggcccatgtatagcaataaattgcgattcgagtccgatatt
catgtacatgaatttccccaacccattatgatcatccatgcagaggatgatgtggtagtg
ccttttaaattgggatatgagctctatcgcatcgcactcgacacgcgtcagcgttcgtgg
ggaccagttgaattccatagatttgagagcaaacacaagtacggacacaagtatttatgc
cgggcacctgaattgcccagtttggtgcaacactttgtggcaaattatcgcgatgccgtc
tactag

DBGET integrated database retrieval system