KEGG   Drosophila willistoni: Dwil_GK18032Help
Entry
Dwil_GK18032      CDS       T01067                                 

Definition
GK18032 gene product from transcript GK18032-RA
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dwil_GK18032
Peptidases [BR:dwi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dwil_GK18032
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dwil_GK18032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 830 aa AA seqDB search
MEELRKHLSKVNVPCGSGTGTGMGTAPIYKDECVYSYDNPETPTGLYVCLNSFLGFGEAY
VRQYATKTGNCVFLHIKREKTLKEREAQDQETDTEAAGPERKITRLAIGVEGGYNETDMA
KKYEIKDTYSIVVSPHLEKKLPYPDPELPMRVTQAVEAILAADSAIAKLEKATLTGTWDG
EVRQTSKYAENLQQLDNGKKIPPSGWKCEKCDLTNNLWLNLTDGSILCGRKFFDGSGGND
HAVAHYNDTKYPLAVKLGTITADGKSDVFSYPEDDMVVDPHLEKHLSHFGINMAAMKKSE
KSMVELELEINQRIGEWSALTESESELTPLAGPGYTGMRNLGNSCYINSVMQVLFVIPDF
QKRFVGNGAECYFKEFPSDPANDFNIQMSKLGNGLQSGKYSSIVENTLDTEHATGISPAM
FKNIVGKNHPDFSTKQQQDANDFYLHLLTLLDRNSRNQSNPADALKFLLEDRVECLASRK
VKYKTREEYSFRLPIPLDKATNLNEVREYQEREQAARESGQRPSGDIVRHKVPLQACLER
FFGSELIEQFFSTAINGKTNAKKSTRLATMPDFLMIHLSKFTLGDDWVPKKLDVSVDMPD
DLDLSSWRSLGGLQSGEEPLPEPPAEQPKFTFDEAVMSELVNMGFPQEACKRACFHTKNS
GLEAASNWLMEHIGDEDISDPFVVPNNSIGDSAANQFVANPESLAMLMSMGFDERQAVAA
LKATDGNVERATDWIFSHADSIDEPQQQSAAVQTTDAPTSTTNATNYRDGSGKYKLVAFI
SHMGTSAQVGHYVCHIRKDGEWVIFNDTKVAKSQNPPKDLGYLYLYMREE
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactacgaaagcatttatctaaggtgaacgttccctgcggctcgggcaccggc
accggcatgggcactgcgcccatatacaaagacgagtgcgtctactcatatgataatccg
gagaccccgacaggtctgtatgtatgcctaaacagtttccttggctttggtgaggcatat
gttaggcagtatgccactaagacgggaaattgtgtgttcctgcatatcaagcgagagaaa
actttgaaggagagagaggcccaggatcaagagactgatacagaggccgctggtccggag
cgtaaaattactcgtctggccattggagtagaaggtggctacaatgagactgatatggcc
aaaaagtatgagatcaaggacacctacagcatcgtagtgtccccccatttggagaaaaag
ttaccctatccagatccagagctgccaatgcgcgtcactcaggcagtggaggcaattttg
gcagccgattcggcaattgcaaaattggagaaggccactttaactggtacttgggatgga
gaagtacgccagacatccaaatacgccgagaatctccagcagctggacaacggcaagaaa
ataccaccatcgggctggaaatgcgagaaatgtgatttgaccaacaatttatggttaaat
cttacggatggttcaatactctgcggccgcaagttctttgatggcagcggtggcaatgat
catgcggttgctcactataatgataccaaatatccattggcggtaaaattgggaactatt
acggcggatggcaagtcggatgtattttcctatccagaagatgatatggtcgttgatcca
catttggaaaagcatctctcccattttggtattaacatggcagccatgaaaaagagcgag
aaatcgatggtggaattggaactcgagatcaaccagcgtatcggcgaatggtccgctttg
acagagagcgaaagcgaactgacacccctagcagggcctggctatacaggaatgcgtaat
ttgggtaattcctgttatattaatagcgtgatgcaagtgcttttcgtcataccagatttc
cagaagcgttttgtgggcaacggtgctgagtgttacttcaaagagtttcctagtgatccg
gccaatgattttaatattcaaatgtcgaagctgggaaatggattacaatcgggcaagtat
agcagcattgtagagaacactttggatacggagcatgctaccggaatatcgcctgccatg
ttcaagaatattgtgggcaagaatcatccggattttagtacgaagcaacaacaggatgcc
aatgacttttatttgcatttgcttaccctattggatcgcaattcgcgcaatcagtccaat
ccggccgatgctttaaagtttttgcttgaggatcgagttgaatgtctggccagtcgtaag
gtcaaatataagacgcgtgaggaatatagtttccgattgcccatccctttggataaggcc
accaatctgaacgaggtgcgcgaataccaggaacgggagcaggccgcccgtgaaagcggc
cagcgtccttcaggagatattgtgcgtcacaaggtgccgttgcaggcttgtctggagcgc
tttttcggctctgaattaatcgagcaattcttttcgacagccattaatggcaaaactaat
gccaagaagtccacccgtttggccactatgcccgatttcctgatgatacatttaagtaag
tttaccttgggcgacgattgggtgcccaagaagctagatgtctcagttgatatgcccgat
gatctggatctatcgtcgtggcgctctctgggcggcctacagagcggcgaggagccattg
ccagagccaccggccgagcagccgaaattcacctttgacgaggctgtcatgtcagagtta
gtcaatatgggtttcccacaggaggcttgtaagcgggcctgcttccacaccaaaaacagc
ggtcttgaagccgcctccaattggctaatggagcacattggcgacgaggatatctctgat
ccgtttgtggtgcccaataacagtattggcgatagtgcggccaatcaatttgtggccaat
cccgaaagtctggccatgttgatgagcatgggattcgatgagcgtcaggctgttgctgcc
ctcaaagccactgatggcaacgttgaacgagccaccgactggattttctcgcacgccgac
agcattgatgagccgcaacaacagtctgctgctgtccagaccacagatgcgccaacttcc
accaccaacgccaccaactatcgcgatggctcgggcaaatataagctggttgcattcatc
tcgcatatgggcacatcggcccaggtgggacattatgtctgtcacatacgcaaggatggc
gaatgggtcattttcaatgacaccaaagtggccaagtctcagaatccgcccaaagatttg
ggctatctgtatctttatatgcgtgaagagtaa

DBGET integrated database retrieval system