KEGG   Drosophila willistoni: Dwil_GK18118Help
Entry
Dwil_GK18118      CDS       T01067                                 

Definition
GK18118 gene product from transcript GK18118-RA
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
dwi  Drosophila willistoni
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dwi00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dwi04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 422 aa AA seqDB search
MRLQTGLLVIFLCVNFSQAFWPWPFTKTHKHKHDPPPPPPPEPKISPVIFVPGDGGCQID
ARLNKNDTPHYICEKTHDWYTLWLDIEELVIPMVYCWIDNVKLYYDKATRTTHNTPGVET
RVPGWGNPEVVENIAPSKSSAGVYFSAIANLLIELGYERKKNILGAPYDFRKAPNENKQF
FIDLKELVEDAYERNNQSAVTFITHSMGSPMTLIFLQEQSADWKSKYIRRQISLAGAWAG
SMKAVKVFAMGDDLDSIALIASILKQEQITHPSSAWLLPSPLFWKPSEVLASTPSRNYTM
SQMKEFFQDLDYMTGWEMRKDTLRYSENFSPPEVELHCLYGDGIPTVESLQYKKDDIANT
TPNLVMGIGDGTVNQRSLRACQHWSGYSSSEINTLALQGVDHMKILTNSDALRYIRTVMK
QP
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaggctccaaacgggattactggttatatttttatgcgttaacttttcgcaagctttt
tggccttggccttttaccaaaactcacaaacataagcatgaccctccgccaccgccacca
cctgagccaaaaatttcacctgtaatatttgttcctggcgatggcggctgtcaaattgat
gctcgcctcaataaaaacgatactccgcattatatatgcgagaagacgcatgattggtat
actctctggttagatatcgaggaattagtgatacccatggtatattgttggattgataat
gttaaattgtattatgataaagctacgcgcacaacacataatacgcctggtgttgagact
cgtgttcccggctggggtaatccagaagtggtggaaaatattgctccttccaaaagtagt
gctggagtttatttcagtgctattgccaatcttttgatcgaattgggctatgagcgtaaa
aagaatatccttggagcaccctatgattttcggaaggctccaaatgagaacaagcaattt
tttatcgacctaaaagaacttgttgaagatgcctatgagaggaataaccaaagtgcagtc
accttcattacacacagtatgggtagcccaatgacattgatctttctacaagaacagagt
gctgactggaaatccaaatatattcgaagacaaattagtttagccggtgcctgggcaggt
agcatgaaggcggttaaagtatttgccatgggtgacgatttggattcaattgcattaatt
gccagtatattgaagcaagagcaaataacccatccatcatctgcctggttgctgccatca
ccattattctggaagccatcggaagtgttggcatcgacaccttcacgcaattatactatg
tcccagatgaaggaattctttcaggatctcgattatatgactggctgggaaatgcgtaag
gatactttgcgttattcggagaatttcagtccgccagaagtggaactacattgcctctat
ggtgatggaattcctactgtcgagagtttacagtacaagaaggatgatatagctaatacc
acgcccaatttggtaatgggtataggcgacggaaccgttaatcaaagatcattgcgagct
tgccaacactggtcgggttattcaagctcagaaattaataccttggccctgcagggtgtc
gatcatatgaaaattttgacgaattcagatgctttgcgttatatacggacagttatgaaa
caaccctaa

DBGET integrated database retrieval system